Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_041360864.1 MCA_RS05285 phosphate ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >NCBI__GCF_000008325.1:WP_041360864.1 Length = 295 Score = 132 bits (333), Expect = 6e-36 Identities = 90/254 (35%), Positives = 137/254 (53%), Gaps = 13/254 (5%) Query: 3 KLEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILL 62 ++ +D++ YG ++ VSL +VI++IG SG GKSTFLRC+N + G + Sbjct: 47 RIMCRDVNVYYGEKHAIQNVSLDVGHNEVIALIGPSGCGKSTFLRCLNRMNDTIVGCRVT 106 Query: 63 NNEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAP-VHVLGM 121 + L DG L +R+++ MVFQ N + + EN+ P +H L Sbjct: 107 GSIRLDGQDIYDGGLDVVP------LRAQVGMVFQKPNPFPK-SIYENVAYGPKIHGLAN 159 Query: 122 SKAEAREKAELYLAKVGV-SHRKD--AYPG-HMSGGEQQRVAIARALAMEPEVMLFDEPT 177 SKAE E E L + G+ KD A PG +SGG+QQR+ IAR +A+ PEV+L DEP Sbjct: 160 SKAELEEIVESSLRRAGLWDEVKDDLAKPGTSLSGGQQQRLCIARTIAVSPEVILMDEPC 219 Query: 178 SALDPELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVL 237 SALDP + +++ L +E T+ +VTH M A VS + + H G + E G+ +V Sbjct: 220 SALDPIATAKIEQLIDEL-RELYTIAIVTHSMQQAARVSQRTAYFHLGRLIEVGDTAQVF 278 Query: 238 VNPQSERLQQFLSG 251 NP+ + +++G Sbjct: 279 TNPRHPLTEDYITG 292 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 295 Length adjustment: 25 Effective length of query: 229 Effective length of database: 270 Effective search space: 61830 Effective search space used: 61830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory