Align Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 (characterized)
to candidate WP_041376778.1 PNAP_RS17155 diaminopimelate epimerase
Query= SwissProt::P0A6K1 (274 letters) >NCBI__GCF_000015505.1:WP_041376778.1 Length = 292 Score = 255 bits (652), Expect = 7e-73 Identities = 144/286 (50%), Positives = 171/286 (59%), Gaps = 12/286 (4%) Query: 1 MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60 ++F+KM G GNDF+++D + SP R LADRH GVG DQ+L V P +DF Y Sbjct: 3 IRFTKMQGAGNDFVMLDETRGPLGLSPAHYRFLADRHFGVGADQILTVRPSPGEGIDFEY 62 Query: 61 RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120 I NADG EV QCGNGARCF RFVR +GLT K ++V T G + + D V VNMG Sbjct: 63 VIHNADGGEVEQCGNGARCFVRFVREQGLTTKDAVKVKTLGGIIEPCMQPDGRVTVNMGA 122 Query: 121 PNFEPSAVPFR--------ANKAEKTYIM---RAAEQTILCGVVSMGNPHCVIQVDDVDT 169 P FE +PF A +K + A + VVSMGNPH V VDDVDT Sbjct: 123 PVFELERIPFNPAGLTPQTAGSWQKWPLALDGHAQAAPVFVAVVSMGNPHAVQLVDDVDT 182 Query: 170 AAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGI 229 A V GP++E H FP R N GFMQVV R IRLRVYERGAGET ACG+GACAAV GI Sbjct: 183 APVLEAGPLIEHHPSFPRRVNAGFMQVVSRSQIRLRVYERGAGETLACGTGACAAVVAGI 242 Query: 230 QQGLLAEEVRVELPGGRLDIAWKGP-GHPLYMTGPAVHVYDGFIHL 274 + GLL V V GG+L I W G P+ MTGPA V++ I + Sbjct: 243 RLGLLDSRVDVLTRGGQLTIEWAGTLDAPVMMTGPATTVFESEIEV 288 Lambda K H 0.323 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 292 Length adjustment: 26 Effective length of query: 248 Effective length of database: 266 Effective search space: 65968 Effective search space used: 65968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
Align candidate WP_041376778.1 PNAP_RS17155 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
../bin/blast/fastacmd -i /tmp/list.23736.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.23736.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.