Align 2-keto-3-deoxy-L-rhamnonate aldolase; KDR aldolase; EC 4.1.2.53; 2-dehydro-3-deoxyrhamnonate aldolase (uncharacterized)
to candidate WP_041379369.1 SWIT_RS21595 4-hydroxy-2-oxoheptanedioate aldolase
Query= curated2:B5R262 (267 letters) >NCBI__GCF_000016765.1:WP_041379369.1 Length = 264 Score = 241 bits (614), Expect = 2e-68 Identities = 121/247 (48%), Positives = 163/247 (65%) Query: 9 FKEGLRKGDTQIGLWLSSTTSYMAEIAATSGYDWLLIDGEHAPNTVQDLYHQLQAIAPYA 68 FK + G QIG W + T Y AEI A +G+DWLLIDGEH PN + + QLQAI Sbjct: 2 FKAAIATGRRQIGFWQALATPYTAEICAGAGFDWLLIDGEHGPNDLPLVLRQLQAIEGSP 61 Query: 69 SQPVIRPIEGSKALIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPLGQRGVGASVAR 128 ++PV+R L+KQ LDIGA+TLL+PM+++A QA +V+A RYPP G RGVG+++ R Sbjct: 62 AEPVVRLPCADTVLVKQYLDIGARTLLVPMIESAAQAAAMVAACRYPPRGVRGVGSAIGR 121 Query: 129 AARWGRIDNYMAQANESLCLLVQVESKVALENLDAILEVEGIDGVFIGPADLSASLGYPD 188 A+RW R Y+ A +CLL+QVES LE AI +G+DGVFIGP+DL+A+LG+ Sbjct: 122 ASRWNRTPGYLHDAERDICLLLQVESVAGLEACHAIAATDGVDGVFIGPSDLAAALGHLG 181 Query: 189 NAGHPEVQRIIESCIYRIRAAGKAAGFLAVDPAMAQKCLAWGANFVAVGVDTMLYTEALD 248 + GHP+VQ I I R+ +AGKAAG LA D +A++ LA GA+FVAVG D + + Sbjct: 182 HPGHPDVQAAIAGAIDRVLSAGKAAGLLAADERLARRYLAAGASFVAVGTDVTVLARGAE 241 Query: 249 SRLAMFK 255 + A F+ Sbjct: 242 ALAARFR 248 Lambda K H 0.318 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 264 Length adjustment: 25 Effective length of query: 242 Effective length of database: 239 Effective search space: 57838 Effective search space used: 57838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory