Align Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 (characterized)
to candidate WP_041456242.1 AVA_RS15605 diaminopimelate epimerase
Query= SwissProt::Q81XR2 (288 letters) >NCBI__GCF_000204075.1:WP_041456242.1 Length = 279 Score = 209 bits (531), Expect = 7e-59 Identities = 118/284 (41%), Positives = 173/284 (60%), Gaps = 20/284 (7%) Query: 6 FTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNI---NTGIGADGMILICPSDVAP-V 61 FTK HGLGN +I ++ + P A+ EK + + GIGADG+I P + Sbjct: 5 FTKYHGLGNDFILIDNRASKTP----AITPEKAVEMCDRHFGIGADGVIFALPGENGTDY 60 Query: 62 KMRMFNNDGSEGKSCGNGLRCVAKYAYEHKLV---EDTVFTIETLAGIVTAEVTVEEGKV 118 MR+FN+DGSE + CGNG+RC+A + + + + +DT + I TLAG++T ++T +G++ Sbjct: 61 TMRIFNSDGSEPEMCGNGIRCLAAFLADLEGLSRNKDT-YRIHTLAGVITPQLT-PDGQI 118 Query: 119 TLAKIDMGAPRLTRAEIPM-LGEGETPFIRENFLYNNHRYAFTAVSMGNPHAVIFVDDVE 177 K+DMG PRL EIP + + I + + T VSMGNPH + FV+DV Sbjct: 119 ---KVDMGLPRLLAGEIPTNIAAADQKVINQPLEVEGKTWEVTCVSMGNPHCITFVEDVA 175 Query: 178 QAPLTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVAS 237 PL T+GP E H FP+R N EFI++++ + + RVWERG+G+T ACGTGACA++VA+ Sbjct: 176 AIPLETIGPKFEHHPAFPQRTNTEFIQVVSRDYLKMRVWERGAGITLACGTGACASLVAA 235 Query: 238 ILNGKMERGKEITVHLAGGDLMIAWTE-EGNVLMKGPAEVICRG 280 +L G+ +R TV L GG L I W+E + + M GPA+ + G Sbjct: 236 VLTGRSDR--LATVELPGGPLEIEWSEVDQRIYMTGPADRVFTG 277 Lambda K H 0.318 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 18 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 279 Length adjustment: 26 Effective length of query: 262 Effective length of database: 253 Effective search space: 66286 Effective search space used: 66286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_041456242.1 AVA_RS15605 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
../bin/blast/fastacmd -i /tmp/list.11460.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.11460.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.