Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate WP_041456726.1 AVA_RS10285 acetolactate synthase small subunit
Query= BRENDA::P9WKJ3 (168 letters) >NCBI__GCF_000204075.1:WP_041456726.1 Length = 173 Score = 167 bits (424), Expect = 7e-47 Identities = 85/154 (55%), Positives = 121/154 (78%) Query: 6 HTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATECKDRSRMTIVVSAEDTPLEQITK 65 HTLSVLVED+ GVL+R+A+LF+RRGFNIESLAVG+ E SR+T+VV +D +EQ+TK Sbjct: 3 HTLSVLVEDEAGVLSRIASLFARRGFNIESLAVGSGEEGGVSRITMVVPGDDRVIEQLTK 62 Query: 66 QLNKLINVIKIVEQDDEHSVSRELALIKVQADAGSRSQVIEAVNLFRANVIDVSPESLTV 125 QL KL+NV+K+ + + V REL L+KV A + +RS+VIE +FRA V+DV+ +SLT+ Sbjct: 63 QLYKLVNVLKVQDITETPCVERELMLLKVNATSSNRSEVIELAQIFRARVVDVAEDSLTL 122 Query: 126 EATGNRGKLEALLRVLEPFGIREIAQSGMVSLSR 159 E G+ GK+ A+++VL+ FGIREIA++G ++L+R Sbjct: 123 EVVGDPGKMVAIVQVLQKFGIREIARTGKIALTR 156 Lambda K H 0.315 0.131 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 173 Length adjustment: 18 Effective length of query: 150 Effective length of database: 155 Effective search space: 23250 Effective search space used: 23250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_041456726.1 AVA_RS10285 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.30668.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.30668.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.