Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_041458893.1 ADEG_RS10380 amino acid ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_000024605.1:WP_041458893.1 Length = 240 Score = 171 bits (433), Expect = 2e-47 Identities = 105/264 (39%), Positives = 149/264 (56%), Gaps = 34/264 (12%) Query: 5 LEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSG 64 +EV+ LYK FG K ++L + + GE+ VI+G SG Sbjct: 2 IEVRGLYKNFG---------------KLEVL---------RGIDCQVAAGEVVVIIGPSG 37 Query: 65 SGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVL 124 SGKST +R LN L EPT G ++IDGV + S ++ VR+K + MVFQSF L PH T L Sbjct: 38 SGKSTFLRCLNFLEEPTAGTIVIDGVKLNH-SSTDINLVRQK-VGMVFQSFNLFPHKTAL 95 Query: 125 DNTAFG-MELAGIAAQERREKALDALRQVGLENYAHAYPDELSGGMRQRVGLARALAINP 183 +N M + + Q+ KA + LR+VGLE AH+YPD+LSGG +QRV +ARALA+ P Sbjct: 96 ENIILAPMVVKKVPRQQAERKAYELLRKVGLEEKAHSYPDQLSGGQQQRVAIARALAMEP 155 Query: 184 DILLMDEAFSALDPLIRTEMQDELVKLQ---AKHQRTIVFISHDLDEAMRIGDRIAIMQN 240 ++L DE SALDP EM E++ + A+ T+V ++H++ A + DR+ M Sbjct: 156 KVMLFDEPTSALDP----EMVGEVLAVMRDLAREGMTMVVVTHEMRFARDVADRVIFMDE 211 Query: 241 GEVVQVGTPDEILNNPANDYVRTF 264 G +V+ G P++I P N R F Sbjct: 212 GRIVEEGPPEKIFREPENPRTRAF 235 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 240 Length adjustment: 27 Effective length of query: 373 Effective length of database: 213 Effective search space: 79449 Effective search space used: 79449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory