Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate WP_041550657.1 SARO_RS02975 4-hydroxyphenylpyruvate dioxygenase
Query= BRENDA::P80064 (357 letters) >NCBI__GCF_000013325.1:WP_041550657.1 Length = 368 Score = 528 bits (1360), Expect = e-155 Identities = 254/360 (70%), Positives = 296/360 (82%), Gaps = 4/360 (1%) Query: 2 DLYENPMGLMGFEFIELASPTPNTLEPIFEIMGFTKVATHRSKDVHLYRQGAINLILNNE 61 DL+ENP+GL GFEFIE ++P +LEP+F MGFT +A HRSK V L+RQG INLI N+E Sbjct: 8 DLFENPLGLDGFEFIEFSAPEAGSLEPVFARMGFTHIANHRSKQVQLWRQGGINLIANHE 67 Query: 62 PHSVASYFAAEHGPSVCGMAFRVKDSQKAYKRALELGAQPIHIETGPMELNLPAIKGIGG 121 P S A+YFAAEHGPS CGM +RV+++ KAY A+E GA+P+ + TGPMEL LPAI+GIGG Sbjct: 68 PRSPAAYFAAEHGPSACGMGWRVRNAAKAYATAIERGAEPVEVRTGPMELRLPAIRGIGG 127 Query: 122 APLYLIDRFGEGS----SIYDIDFVFLEGVDRHPVGAGLKIIDHLTHNVYRGRMAYWANF 177 + +YLIDR+ G SIYDIDF +L GVDRHPVGAG IDHLTHNVY GRMA+WA+F Sbjct: 128 SIIYLIDRYEGGQFGDLSIYDIDFEYLPGVDRHPVGAGFHTIDHLTHNVYGGRMAHWASF 187 Query: 178 YEKLFNFREIRYFDIKGEYTGLTSKAMTAPDGMIRIPLNEESSKGAGQIEEFLMQFNGEG 237 YE++F FREIRYFDIKGEYTGLTS+AMTAPDG IRIPLNEE+ G GQIEEFL +NGEG Sbjct: 188 YERVFGFREIRYFDIKGEYTGLTSRAMTAPDGKIRIPLNEEAKAGGGQIEEFLRAYNGEG 247 Query: 238 IQHVAFLSDDLIKTWDHLKSIGMRFMTAPPDTYYEMLEGRLPNHGEPVGELQARGILLDG 297 IQH+AF DDL+ WD LK+IG FM+ PP TYYEML+ RLP HGEPV ELQ RGILLDG Sbjct: 248 IQHIAFACDDLLGGWDKLKAIGTPFMSPPPATYYEMLDERLPGHGEPVAELQKRGILLDG 307 Query: 298 SSESGDKRLLLQIFSETLMGPVFFEFIQRKGDDGFGEGNFKALFESIERDQVRRGVLSTD 357 S+E GD RLLLQIFSET +GPVFFEFIQRK D+GFGEGNF ALF+S+ERDQ+RRGVL T+ Sbjct: 308 STEEGDPRLLLQIFSETQIGPVFFEFIQRKRDEGFGEGNFTALFKSMERDQLRRGVLKTE 367 Lambda K H 0.321 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 571 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 368 Length adjustment: 29 Effective length of query: 328 Effective length of database: 339 Effective search space: 111192 Effective search space used: 111192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_041550657.1 SARO_RS02975 (4-hydroxyphenylpyruvate dioxygenase)
to HMM TIGR01263 (hppD: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01263.hmm # target sequence database: /tmp/gapView.462094.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01263 [M=353] Accession: TIGR01263 Description: 4HPPD: 4-hydroxyphenylpyruvate dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-115 372.0 0.0 2.3e-115 371.8 0.0 1.0 1 NCBI__GCF_000013325.1:WP_041550657.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000013325.1:WP_041550657.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 371.8 0.0 2.3e-115 2.3e-115 2 353 .] 18 364 .. 17 364 .. 0.95 Alignments for each domain: == domain 1 score: 371.8 bits; conditional E-value: 2.3e-115 TIGR01263 2 gfdfvefavgdakqaakalveklGfeavaketgsrekastvlrqgeitlvltaelsssseaaaflakHGdgvk 74 gf+f+ef +++a +++ ++ ++Gf+ +a+ +r+k++ ++rqg i+l+ ++e++s aa f+a+HG++++ NCBI__GCF_000013325.1:WP_041550657.1 18 GFEFIEFSAPEAG-SLEPVFARMGFTHIAN---HRSKQVQLWRQGGINLIANHEPRSP--AAYFAAEHGPSAC 84 8***********9.9**************9...*******************999998..************* PP TIGR01263 75 dvafevedveaafeaavergaeavsapeeedekevklaaikgiGdvvltlvereg..ekg..silpgfeevse 143 +++++v+++++a+++a+ergae+v+ + +e++l+ai+giG+++++l++r++ + g si+++++e NCBI__GCF_000013325.1:WP_041550657.1 85 GMGWRVRNAAKAYATAIERGAEPVEVRTG--PMELRLPAIRGIGGSIIYLIDRYEggQFGdlSIYDIDFEYLP 155 ***********************999985..99********************98443332268888887777 PP TIGR01263 144 kaalkekledvgleaiDHvvgnvergelekvaefyekilgfkeiksfdikteasaLkSkvlasaegkvklpln 216 +++++ ++g+++iDH+++nv+ g++ ++a+fye+++gf+ei++fdik+e+++L+S+++++++gk+++pln NCBI__GCF_000013325.1:WP_041550657.1 156 G--VDRHPVGAGFHTIDHLTHNVYGGRMAHWASFYERVFGFREIRYFDIKGEYTGLTSRAMTAPDGKIRIPLN 226 6..788889**************************************************************** PP TIGR01263 217 epaskkkksQIeeyleeyeGaGvQHlAlntedivktveelrargveflk.ipetYYdnlkervkklvkedlee 288 e + k +QIee+l++y+G+G+QH+A+ +d++ +++l+a g+ f++ +p tYY++l+er++ + e++ e NCBI__GCF_000013325.1:WP_041550657.1 227 E-EAKAGGGQIEEFLRAYNGEGIQHIAFACDDLLGGWDKLKAIGTPFMSpPPATYYEMLDERLPG-HGEPVAE 297 *.78999******************************************9999***********7.******* PP TIGR01263 289 lkelkiLvDrd.eeG...lLLQiFtkpvvdrgtlFfEiIqRkgakGFGegNfkaLfeaiEreqekrgvl 353 l++++iL+D++ eeG lLLQiF+++ + g++FfE+IqRk+++GFGegNf aLf+++Er+q +rgvl NCBI__GCF_000013325.1:WP_041550657.1 298 LQKRGILLDGStEEGdprLLLQIFSETQI--GPVFFEFIQRKRDEGFGEGNFTALFKSMERDQLRRGVL 364 **********9999***9**********9..***********************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (353 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 25.10 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory