Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_041551665.1 SARO_RS19665 acetyl-CoA C-acyltransferase
Query= BRENDA::Q0K368 (391 letters) >NCBI__GCF_000013325.1:WP_041551665.1 Length = 383 Score = 389 bits (998), Expect = e-112 Identities = 208/393 (52%), Positives = 271/393 (68%), Gaps = 12/393 (3%) Query: 1 MAEAYIVAAVRTAGGRKGGKLSGWHPADLAAQVLDALVERTGADPALVEDVIMGCVSQVG 60 M EAYI+ AVRT GRK G L+ HPADLAA + L+ R DPALVEDV+ GC +G Sbjct: 1 MPEAYIIDAVRTPVGRKKGGLAHLHPADLAAHPIRELMARHDFDPALVEDVVWGCTETIG 60 Query: 61 EQAGNVARNAILASRLPESVPGTSVDRQCGSSQQALHFAAQAVMSGAMDIVIAAGVESMT 120 QAG++ R A L + L E VPG +VDRQCGS+QQA+HFAAQ VMSG DIV+A G ++M Sbjct: 61 GQAGDIGRTAWLVAGLAEDVPGVTVDRQCGSAQQAVHFAAQGVMSGTQDIVVAGGSQAMN 120 Query: 121 RVPMGLSSQLPAKNGFGVP--KSPGIEARYPGVQFSQFTGAEMIARKYDLSREQLDAYAL 178 R+P+ + A GF P + G +ARY + +Q AEMIA K++LSRE++DA+A Sbjct: 121 RIPIMAAMTAGAAYGFESPFIGAKGWDARYGDQEVNQIRSAEMIAEKWNLSREEMDAFAY 180 Query: 179 QSHQRAIAATKSGRFTAEILPVEVRTADGANGEMHTTDEGVRYDATLESIGSVKLIAEGG 238 +SH+RA AT+ G F EI+P+E G + DE +R TLE + S+ + EGG Sbjct: 181 ESHRRAQYATEQGWFRNEIVPLE-----GLD-----RDETIRPGTTLEGLASLSAVREGG 230 Query: 239 RVTAASASQICDGAAGLMVVNEAGLKKLGVKPLARVHAMTVIGHDPVVMLEAPLPATEVA 298 RVTA +ASQ D AA L++V+E +K+ +KP AR+H M+V +PV ML P+PAT A Sbjct: 231 RVTAGNASQNSDCAAALLIVSERAVKEHNLKPRARIHHMSVRADNPVWMLTGPIPATRYA 290 Query: 299 LKKAGLRIGDIDLFEVNEAFAPVPLAWLKATGADPARLNVHGGAIALGHPLGGSGAKLMT 358 ++K+G+++ DIDLFE NEAFA VP+AW+K ++NV GGAIALGHP+G +GAKLMT Sbjct: 291 MQKSGMKLSDIDLFECNEAFASVPMAWMKELDIPHEKVNVSGGAIALGHPIGSTGAKLMT 350 Query: 359 TLVHALHTHGKRYGLQTMCEGGGLANVTIVERL 391 TL++AL G RYGLQTMCEGGG ANVTI+ERL Sbjct: 351 TLLNALERTGGRYGLQTMCEGGGQANVTIIERL 383 Lambda K H 0.317 0.132 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 383 Length adjustment: 30 Effective length of query: 361 Effective length of database: 353 Effective search space: 127433 Effective search space used: 127433 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory