Align BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC (characterized)
to candidate WP_041575968.1 XAUT_RS19760 branched-chain amino acid ABC transporter substrate-binding protein
Query= TCDB::Q9L3M3 (381 letters) >NCBI__GCF_000017645.1:WP_041575968.1 Length = 366 Score = 425 bits (1092), Expect = e-123 Identities = 209/359 (58%), Positives = 262/359 (72%) Query: 1 MKKSLLSAVALTAMLAFSGNAWADVLIAVAGPLTGPNAAFGAQLQKGAEQAAADINAAGG 60 MKK L++++AL A L + A A V + V GP+TG NAAFGAQL+ GAEQA ADINAAGG Sbjct: 1 MKKLLMASLALGASLLLAAEAQAQVKMGVGGPMTGANAAFGAQLKTGAEQAVADINAAGG 60 Query: 61 INGEQIKIELGDDVSDPKQGISVANKFAADGVKFVIGHFNSGVSIPASEVYAENGILRNH 120 I G++I++ +GDD P+QG S ANKF +DGVKFV+GHFNSGVSIP S+ Y E G+L+ Sbjct: 61 ILGQKIQLSVGDDGGKPEQGKSAANKFISDGVKFVVGHFNSGVSIPTSQDYEEAGVLQIS 120 Query: 121 PGRDEPDLHGTGLWNTFRTCGRDDQQGAIAGKYLADHFKDAKIAVVHDKTPYGQGLADET 180 P P +WNTFRTCGRDDQQGA+AG Y+ +FK K+A+VHDKTPYG+GLADET Sbjct: 121 PASTNPTFTERKMWNTFRTCGRDDQQGAVAGAYIVKNFKGKKVAIVHDKTPYGKGLADET 180 Query: 181 KKAMNAAGVTEVIYEGINVGDKDFSALIAKMKEAGVSIIYWGGLHTEAGLIIRQAADQGL 240 +K +N GV EV+YEGIN G+KD+SAL++K+K GV ++Y+GGLH EAGL++RQ DQG+ Sbjct: 181 QKTINKGGVKEVLYEGINPGEKDYSALVSKLKANGVDLLYYGGLHPEAGLLVRQMRDQGM 240 Query: 241 KATLVSGDGIVSNELASIAGDAVAGTLNTFGPDPTANPANKELVEKFKAAGFNPEAYTLY 300 K L SGDGI E +IAG GTL TFGPDP NPA K++V FKA G +PE Y LY Sbjct: 241 KTVLFSGDGITDKEYWTIAGPGAEGTLMTFGPDPRNNPAAKDIVAAFKAKGVDPEGYVLY 300 Query: 301 SYAAMQTIAGAAKAAGSLDPEAVAKAMKEKGPFPTVLGDISFDEKGDPKIPGYIMYEWK 359 SYAA+Q + AA+AA SLDP+ VA + F TVLG +SFD+KGD Y++Y WK Sbjct: 301 SYAAVQVMKQAAEAAKSLDPKKVAAEIHSGKTFNTVLGPLSFDKKGDITKLDYVVYVWK 359 Lambda K H 0.314 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 366 Length adjustment: 30 Effective length of query: 351 Effective length of database: 336 Effective search space: 117936 Effective search space used: 117936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory