Align Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale)
to candidate WP_041575968.1 XAUT_RS19760 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:G8ALJ3 (366 letters) >NCBI__GCF_000017645.1:WP_041575968.1 Length = 366 Score = 419 bits (1076), Expect = e-122 Identities = 204/366 (55%), Positives = 256/366 (69%), Gaps = 1/366 (0%) Query: 1 MNYKLSLLVAVAATAMTASVAKADIAVATAGPITGQYATFGEQMKKGIEQAVADINAAGG 60 M L +A+ A+ + A+ A+A + + GP+TG A FG Q+K G EQAVADINAAGG Sbjct: 1 MKKLLMASLALGASLLLAAEAQAQVKMGVGGPMTGANAAFGAQLKTGAEQAVADINAAGG 60 Query: 61 VLGQKLKLEVGDDACDPKQAVAVANQLAKAGVKFVAGHFCSGSSIPASQVYAEEGVLQIS 120 +LGQK++L VGDD P+Q + AN+ GVKFV GHF SG SIP SQ Y E GVLQIS Sbjct: 61 ILGQKIQLSVGDDGGKPEQGKSAANKFISDGVKFVVGHFNSGVSIPTSQDYEEAGVLQIS 120 Query: 121 PASTNPKLTEQNLKNVFRVCGRDDQQGQIAGKYLLENYKGKNVAILHDKSAYGKGLADET 180 PASTNP TE+ + N FR CGRDDQQG +AG Y+++N+KGK VAI+HDK+ YGKGLADET Sbjct: 121 PASTNPTFTERKMWNTFRTCGRDDQQGAVAGAYIVKNFKGKKVAIVHDKTPYGKGLADET 180 Query: 181 QKALNAGGQKEKIYEAYTAGEKDYSALVSKLKQEAVDVVYVGGYHTEAGLLARQMKDQGL 240 QK +N GG KE +YE GEKDYSALVSKLK VD++Y GG H EAGLL RQM+DQG+ Sbjct: 181 QKTINKGGVKEVLYEGINPGEKDYSALVSKLKANGVDLLYYGGLHPEAGLLVRQMRDQGM 240 Query: 241 NAPIVSGDALVTNEYWAITGPAGENTMMTFGPDPREMPEAKEAVEKFRKAGYEPEGYTLY 300 + SGD + EYW I GP E T+MTFGPDPR P AK+ V F+ G +PEGY LY Sbjct: 241 KTVLFSGDGITDKEYWTIAGPGAEGTLMTFGPDPRNNPAAKDIVAAFKAKGVDPEGYVLY 300 Query: 301 TYAALQIWAEAAKQANSTDSAKI-ADVLRKNSYNTVIGKIGFDAKGDVTSPAYVWYRWNN 359 +YAA+Q+ +AA+ A S D K+ A++ ++NTV+G + FD KGD+T YV Y W + Sbjct: 301 SYAAVQVMKQAAEAAKSLDPKKVAAEIHSGKTFNTVLGPLSFDKKGDITKLDYVVYVWKD 360 Query: 360 GQYAQV 365 G Y Q+ Sbjct: 361 GAYTQL 366 Lambda K H 0.312 0.129 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 366 Length adjustment: 30 Effective length of query: 336 Effective length of database: 336 Effective search space: 112896 Effective search space used: 112896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory