Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_041642232.1 AZO_RS02365 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >NCBI__GCF_000061505.1:WP_041642232.1 Length = 398 Score = 329 bits (844), Expect = 8e-95 Identities = 201/414 (48%), Positives = 248/414 (59%), Gaps = 33/414 (7%) Query: 1 MNEALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQA 60 + +A I+ AVRTP+ + GA VR DD+ A L+A++A+ P LD + DVI GCA Sbjct: 5 IQDAYIVAAVRTPVAKRNGAFRHVRPDDMLAHVLRAVVAQVPALDAGEIGDVITGCAMPE 64 Query: 61 GEDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESM 120 E NVAR+ LLAGLP VPG TLNR C S L AV AA +R GEA +M+A G ESM Sbjct: 65 AEQGMNVARIGLLLAGLPERVPGVTLNRFCASSLQAVADAANRIRLGEADVMIAAGTESM 124 Query: 121 SRAPFVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRAD 180 S P +MG + EIF R N + G G+ TAE VA ++ +SRAD Sbjct: 125 SAMPQIMGNKVSL---NPEIFA-----RQENIDIAYGMGL-----TAEKVAEEWKVSRAD 171 Query: 181 QDAFALRSQHKAAAAIANGRLAKEIV-------------AVEIAQRKGPAKIVEHDEHPR 227 QDAFAL+S +A+AAIA+G EI V IA+R IV+ DE PR Sbjct: 172 QDAFALQSHQRASAAIADGSFGDEIAPYTVRSHLPGEGGTVRIAER-----IVDTDEGPR 226 Query: 228 GDTTLEQLAKLGTPFRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMAT 287 D TLE LA+L F GSVTAGN+S ++DGA A+LL S A QR+G+ AR A Sbjct: 227 ADATLEALARLKPVFAARGSVTAGNSSQMSDGAGAVLLMSETALQRYGVTPLARFRSYAV 286 Query: 288 AGVEPRIMGIGPVPATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVN 347 AGV PR+MGIGPV A + L L GL L +D IELNEAFAAQ LAV+R LGL D RVN Sbjct: 287 AGVPPRVMGIGPVEAIPRALRLAGLGLDALDRIELNEAFAAQALAVIRTLGL--DPARVN 344 Query: 348 PNGGAIALGHPLGMSGARLVTTALHELEERQGRYALCTMCIGVGQGIALIIERI 401 P GGAIALGHPLG +GA T + + + R+ + TMC+G G G A I ER+ Sbjct: 345 PQGGAIALGHPLGATGAIRTATLMRAMRQGGVRHGMITMCVGTGMGAAAIFERV 398 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 398 Length adjustment: 31 Effective length of query: 370 Effective length of database: 367 Effective search space: 135790 Effective search space used: 135790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory