Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_041755184.1 PST_RS00435 dTDP-glucose 4,6-dehydratase
Query= BRENDA::P9WN67 (314 letters) >NCBI__GCF_000013785.1:WP_041755184.1 Length = 356 Score = 144 bits (364), Expect = 2e-39 Identities = 111/337 (32%), Positives = 164/337 (48%), Gaps = 36/337 (10%) Query: 1 MRALVTGAAGFIGSTLVDRLLADG-HSVVGLDNFATGRATNLEHLAD---NSAHVFVEAD 56 MR LVTG AGFIGS L+ L+ D HSV+ LD A NLE LA N + F++AD Sbjct: 1 MRILVTGGAGFIGSALIRHLILDTEHSVLNLDKLTY--AGNLESLASVEGNPRYQFLQAD 58 Query: 57 IVTAD-LHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAAR------ 109 I + + L +P+ + HLAA+ V RS+ P N++GT +L EAAR Sbjct: 59 IADRERVSEALLDFQPDAIMHLAAESHVDRSIDGPAEFIQTNIVGTYQLLEAARAYWQTL 118 Query: 110 ---QTGVRKIVHTSSG---GSIYGTPPEYPTPETAPTDPASPYAAGKVAGEIYLNTFRHL 163 + + H S+ G ++G + ET P P+SPY+A K + + + ++ Sbjct: 119 PAERRAAFRFHHISTDEVYGDLHGVDDLFT--ETTPYAPSSPYSASKASSDHLVRAWQRT 176 Query: 164 YGLDCSHIAPANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVD 223 YGL +N YGP P +V + A L GKP V+GDG+ RD++FV+D Sbjct: 177 YGLPVLITNCSNNYGPFHFPEKLIPLVILNA---LDGKPLPVYGDGSQIRDWLFVEDHAR 233 Query: 224 AFVRVSADVGGGLRFNIGTGKETSDRQLHSAVAAAVG--GPDDP----------EFHPPR 271 A +V ++ G +NIG E + ++ + A + P+ P F R Sbjct: 234 ALFKVVSEGKVGETYNIGGHNEQKNIEVVRGICALLEELAPNKPAGLARYEDLITFVKDR 293 Query: 272 LGDLKRSCLDIGLAERVLGWRPQIELADGVRRTVEYF 308 G R +D ER LGW PQ G+R+TV+++ Sbjct: 294 PGHDLRYAIDASKIERELGWVPQETFQSGLRKTVQWY 330 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 356 Length adjustment: 28 Effective length of query: 286 Effective length of database: 328 Effective search space: 93808 Effective search space used: 93808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory