Align SmoF, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_041779083.1 BIND_RS19250 sugar ABC transporter permease
Query= TCDB::O30832 (290 letters) >NCBI__GCF_000019845.1:WP_041779083.1 Length = 290 Score = 440 bits (1132), Expect = e-128 Identities = 217/290 (74%), Positives = 252/290 (86%) Query: 1 MATQHSKTAARLMISPAVILLFLWMIVPLSMTLYFSFLRYNLLMPGMESFTGWDNYYYFL 60 MAT H+++AARLM++P+V+LL WMI+PL+MT+YFSFLRYNLLMPG E F G NY YFL Sbjct: 1 MATLHTRSAARLMMAPSVLLLLAWMIIPLAMTIYFSFLRYNLLMPGTEEFAGLANYQYFL 60 Query: 61 TDPAFSAALTNTILLVVGVLLITVVGGVLLALLLDQPFWGQGIVRVLVIAPFFVMPTVSA 120 TDPAF AL NT+L+V GVLLITV+GG+ LALLLDQP +GQGIVR+LVIAPFFVMPTVSA Sbjct: 61 TDPAFFTALANTLLIVGGVLLITVIGGIALALLLDQPMYGQGIVRILVIAPFFVMPTVSA 120 Query: 121 LVWKNMFMNPVNGMFAHIARGLGLPPFDFLSQAPLASIIGIVAWQWLPFATLILLTALQS 180 LVWKNMFMNPVNG+FA IA GL P D+L+ PL SII I+AWQWLPF+TLILLTALQS Sbjct: 121 LVWKNMFMNPVNGLFAWIAGSFGLQPIDWLASVPLLSIIIIIAWQWLPFSTLILLTALQS 180 Query: 181 LDREQMEAAEMDGASALDRFIHITVPHLTRAITVVVLIQTIFLLGVFAEILVTTNGGPGT 240 L+ EQ EAAEMDGA A+ FI+I +PH+ RAITVVVLIQTIFLL VFAEILVTTNGGPG Sbjct: 181 LNEEQKEAAEMDGAGAISTFIYIVLPHMARAITVVVLIQTIFLLSVFAEILVTTNGGPGV 240 Query: 241 ASTNITYLVYAQSLLNYDVGGGSAGGIVAVVLANIVAIFLMRMIGKNLDA 290 STN+T+LVY Q+LL +D+GG SAGGIVAVVLANIVA+FL+R+IGKNL+A Sbjct: 241 QSTNLTFLVYTQALLQFDIGGASAGGIVAVVLANIVAVFLIRLIGKNLEA 290 Lambda K H 0.329 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 290 Length adjustment: 26 Effective length of query: 264 Effective length of database: 264 Effective search space: 69696 Effective search space used: 69696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory