Align Acetate/monochloroacetate permease, Deh4p, of 468 aas and 12 TMSs (characterized)
to candidate WP_041936398.1 RL_RS17010 MFS transporter
Query= TCDB::M1Q159 (468 letters) >NCBI__GCF_000009265.1:WP_041936398.1 Length = 437 Score = 199 bits (505), Expect = 2e-55 Identities = 145/436 (33%), Positives = 216/436 (49%), Gaps = 47/436 (10%) Query: 15 KVIFASSAGTVIEWYDFYIFGALATTLASK-FYNTGTPIGDIIAWLGTFAVGFLVRPFGA 73 +V+ AS GT IE++DFY++ A + F+ + L TF++ F RP GA Sbjct: 23 RVLIASLVGTTIEFFDFYVYATAAVLVFPHLFFPASDTNAATLQSLVTFSIAFFARPIGA 82 Query: 74 IVFGRIGDLVGRKFTYLITITIMGSCTFLIGLLPTQDVLGAWAGIILITMRILQGLALGG 133 +VFG GD +GRK T + + MG T LIG+LP D +G A ++L R QGL LGG Sbjct: 83 VVFGHFGDRIGRKATLVAALMTMGLSTVLIGMLPGYDAIGIAAPLLLALCRFGQGLGLGG 142 Query: 134 QYGGAATFVAEHAPQGKRGFYTSWIQTTATFGLLISLGVILITRISLGEADFNEWGWRLP 193 ++GGA E+AP GKR +Y + Q A G ++S G LI ++ DF ++GWR+P Sbjct: 143 EWGGAVLLATENAPPGKRSWYAMFPQLGAPIGFILSSGFFLILAETMSNEDFLDYGWRIP 202 Query: 194 FMASILLVILSLWIRRALKESPLFQQLKDTKAVSKNPLKESFANPYNLRWVLIALFGATM 253 F+AS+ LV + L++R + E+P F++ + P++ F N +LR +++ F A Sbjct: 203 FIASLALVAVGLYVRLKIAETPEFRKAVEKHERVAVPIEVVFRN--HLRSLILGTFIAV- 259 Query: 254 GQGVVWYTGQFYALFYLQKIF-----NTPLIDSNLIVGAA--LLLSMPFFVFFGS----- 301 + LFYL +F TPL L L++ + VFFG Sbjct: 260 ---------ATFVLFYLMTVFTLSWGTTPLEKGGLGYSREQFLVVQLVGVVFFGLTIPLS 310 Query: 302 --LSDRIGRKKVMLSGMLLAVLTYYPIYGLMAAFAPTDPGQHFLFAYIGYNPVILGLLVF 359 LSD R +++L+ +A+ + Y + T FL + IG L L+ F Sbjct: 311 GWLSDLYSR-RIILTLTTIAIAIFGFFYATLLTSGLTGA---FLCSIIG-----LALMGF 361 Query: 360 IQVIYVTMVYGPIAAFLVELFPTKIRYTSMSLPYHIGNGVFG-GLVPMIGLILINATGND 418 YGPI A L FPT +RYT S+ +++G G+FG L P I L D Sbjct: 362 --------TYGPIGAALAAPFPTTVRYTGASMTFNLG-GIFGASLAPYIATWLATHYSLD 412 Query: 419 FAGLWWPMAIAGICLV 434 + G ++ A A I LV Sbjct: 413 YVG-YYLAASAVISLV 427 Lambda K H 0.328 0.144 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 603 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 437 Length adjustment: 33 Effective length of query: 435 Effective length of database: 404 Effective search space: 175740 Effective search space used: 175740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory