Align 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 (characterized)
to candidate WP_041936699.1 RL_RS25565 dehydrogenase
Query= SwissProt::Q5SLR3 (324 letters) >NCBI__GCF_000009265.1:WP_041936699.1 Length = 821 Score = 202 bits (513), Expect = 3e-56 Identities = 123/299 (41%), Positives = 176/299 (58%), Gaps = 8/299 (2%) Query: 1 MALMTMVQALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLLQKYGPDRVMDTPLSE 60 M +T+ AL ++ M D +V GE+ + GG F V GL + DR+ ++P+SE Sbjct: 472 MRAITLRDALFESVLHHMTHDGSLVAYGEECREWGGAFGVYRGLAEILPHDRLFNSPISE 531 Query: 61 AAIVGAALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSG 120 AAIV A+G A G R + E+ + D++ D++ +Q+AK + SGG+ P+V+R G Sbjct: 532 AAIVATAVGFALEGGRALVELMYGDFLGRAGDEVFNQMAKWQSMSGGELKVPVVLRCSIG 591 Query: 121 GGVRGGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEPKRLYRSV 180 + G HSQ A H GLKVV +TPYDAKGLL +A+ DPVVF E +RLY +V Sbjct: 592 S--KYGAQHSQDWTALCAHIPGLKVVYPATPYDAKGLLASALSGNDPVVFFESQRLYDTV 649 Query: 181 K----EEVPEEDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKA-GVSAEVLD 235 + E VP Y LPIG+ +R G+D+T++ G + L AA EL G+S EV+D Sbjct: 650 EEFRNEGVPTGYYQLPIGEPDCKRAGEDVTILTVGPSLYSALAAAEELESTFGISVEVID 709 Query: 236 LRTLMPWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTG 294 R+L+P++YE V+ S+ KTGR+VLVS+A SF+ +AA I + L A P RV G Sbjct: 710 ARSLVPFNYEPVLASIRKTGRIVLVSEASERGSFLMTLAANITRFGYETLHAAP-RVIG 767 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 821 Length adjustment: 35 Effective length of query: 289 Effective length of database: 786 Effective search space: 227154 Effective search space used: 227154 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory