Align furfuryl alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_041936742.1 RL_RS26020 alcohol dehydrogenase AdhP
Query= metacyc::MONOMER-17184 (342 letters) >NCBI__GCF_000009265.1:WP_041936742.1 Length = 360 Score = 456 bits (1172), Expect = e-133 Identities = 221/339 (65%), Positives = 264/339 (77%), Gaps = 1/339 (0%) Query: 4 MMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTDLHAADGDWPVKPTLPFIP 63 +MKAAVVR FG PL I+ VPVP PGPG++ VK+ A GVCHTDLHAADGDWPVKPT PFIP Sbjct: 8 LMKAAVVREFGKPLAIECVPVPVPGPGEILVKVVACGVCHTDLHAADGDWPVKPTPPFIP 67 Query: 64 GHEGVGYVSAVGSGVSRVKEGDRVGVPWLYSACGYCEHCLQGWETLCEKQQNTGYSVNGG 123 GHE G V+A+GSGV+ KEGD VGV WL+ AC CE+C GWETLCE Q NTGYS NGG Sbjct: 68 GHEAAGIVAALGSGVTEFKEGDAVGVAWLHDACLRCEYCETGWETLCEHQHNTGYSCNGG 127 Query: 124 YGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKGLKVTDTRPGQWVVISGIGGLGHV 183 + EYV+A + LP V F EIAPILCAGVT YKGLK T+ RPG+WV ISG+GGLGHV Sbjct: 128 FAEYVIASAAFAARLPQNVNFSEIAPILCAGVTTYKGLKETEARPGEWVAISGVGGLGHV 187 Query: 184 AVQYARAMGLRVAAVDIDDAKLNLARRLGAEVAVNARDTDPAAWLQK-EIGGAHGVLVTA 242 A+QYA+AMGL+V A+D+ AKL+LAR++GA++A+N D + K GGAHGVLVTA Sbjct: 188 AIQYAKAMGLKVVALDVAAAKLDLARQVGADLALNVLSEDTIEKVLKVTSGGAHGVLVTA 247 Query: 243 VSPKAFSQAIGMVRRGGTIALNGLPPGDFGTPIFDVVLKGITIRGSIVGTRSDLQESLDF 302 VSP AFSQA+ MVRR GT++L GLPPG+F PIFDVVLK IT+RGSIVGTR DL E+L F Sbjct: 248 VSPPAFSQALSMVRRKGTVSLVGLPPGNFPMPIFDVVLKRITVRGSIVGTRRDLDEALAF 307 Query: 303 AAHGDVKATVSTAKLDDVNDVFGRLREGKVEGRVVLDFS 341 A G V+A ++ A LDD+ND+F L+ G +EGR+VLD + Sbjct: 308 ATEGRVRAEIAKAPLDDINDIFAGLKAGTIEGRMVLDIA 346 Lambda K H 0.319 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 360 Length adjustment: 29 Effective length of query: 313 Effective length of database: 331 Effective search space: 103603 Effective search space used: 103603 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory