Align deoxynucleoside transporter, ATPase component (characterized)
to candidate WP_041936920.1 RL_RS31840 sugar ABC transporter ATP-binding protein
Query= reanno::Burk376:H281DRAFT_01113 (515 letters) >NCBI__GCF_000009265.1:WP_041936920.1 Length = 511 Score = 344 bits (883), Expect = 4e-99 Identities = 190/500 (38%), Positives = 299/500 (59%), Gaps = 10/500 (2%) Query: 16 LEVVGVHKRFTGVHALRGVSLSFQRGQIYHLLGENGCGKSTLIKIISGAQPPDEGQLVIE 75 LE+ G+ + F GV AL VS++ G + L+GENG GKSTL+KI++G P+EG+++++ Sbjct: 21 LEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTGIYRPNEGEILVD 80 Query: 76 GVPHARLSALEALAAGIETVYQDLSLLPNMSVAENVALTSELATHEGRLARTFDRRVLAA 135 G P SA A+ AG+ ++Q+ L ++VAEN+ L T RT D + + + Sbjct: 81 GQPVTFASAQAAIDAGVTAIHQETVLFDELTVAENIFLGHAPRTR----LRTIDWQAMNS 136 Query: 136 TAARALEAVGLPGNSEFQSTL-IEQLPLATRQLVAIARAIASEAKFVIMDEPTTSLTQKE 194 A L A+ S T+ ++ +A R LVAIARA++ EA+ VIMDEPT +L++KE Sbjct: 137 RAKALLTAL----ESNIDPTIRLKDFSIAQRHLVAIARALSIEARIVIMDEPTAALSRKE 192 Query: 195 VDNLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAEFTKAQISEL 254 +D+L ++ L+ +G +LF+SHK DE Y I + +V RDG+ + QG + E + +I + Sbjct: 193 IDDLFRIVRGLKEKGKAILFISHKFDEVYEIADDFVVFRDGRAVGQGRLKETPQDEIVRM 252 Query: 255 MTGRHLSNERYRESAHAQDIVLDVRGFTRAGQFSDVSFKLHGGEILGVTGLLDSGRNELA 314 M GR + N + VL++R ++ +F D+SF L GEILG+ GL+ +GR+EL+ Sbjct: 253 MVGRDVENAFPKVDVAFGGPVLEIRNYSHRTEFRDISFTLRQGEILGIYGLIGAGRSELS 312 Query: 315 RALAGVAPAQSGDVLLDGQQIALRTPSDAKRHRIGYVPEDRLNEGLFLDKPIRDNVITAM 374 ++L G+ SG ++L+G++I + +P DA R I YVPE+R GL L PI N+ Sbjct: 313 QSLFGITRPLSGKMMLEGREITIHSPQDAIRAGIVYVPEERGRHGLALPMPIFQNMTLPS 372 Query: 375 ISSLRDRFGQIDRTRAQALAEQTVKELQIATPGVDKPVQSLSGGNQQRVLIGRWLAIDPR 434 ++ R G + ALA + + L + + PV +LSGGNQQ+V+IG+WLA P+ Sbjct: 373 LTRTSRR-GFLRAAEEFALARKYAERLDLRAAALSVPVGTLSGGNQQKVVIGKWLATAPK 431 Query: 435 VLILHGPTVGVDVGSKDIIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMMKKGHVSA 494 V+IL PT G+D+GSK ++ + L+ G+ II++S +LPE++ DR+L+MK+G + Sbjct: 432 VIILDEPTKGIDIGSKAAVHGFISELAAEGLSIIMVSSELPEIIGMSDRVLVMKEGLAAG 491 Query: 495 EYRADELSEADLYHALLSEA 514 + ELS L A A Sbjct: 492 IFERAELSPEALVRAATGNA 511 Lambda K H 0.319 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 608 Number of extensions: 31 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 511 Length adjustment: 35 Effective length of query: 480 Effective length of database: 476 Effective search space: 228480 Effective search space used: 228480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory