Align 3-methyl-2-oxobutanoate dehydrogenase subunit alpha; Branched-chain alpha-ketoacid dehydrogenase E1 component subunit alpha; BCKADH E1-alpha; EC 1.2.4.4 (characterized)
to candidate WP_041940013.1 FRAAL_RS00345 pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
Query= SwissProt::P9WIS3 (367 letters) >NCBI__GCF_000058485.1:WP_041940013.1 Length = 424 Score = 271 bits (694), Expect = 2e-77 Identities = 154/333 (46%), Positives = 191/333 (57%), Gaps = 1/333 (0%) Query: 35 YHRDLPEETLRWLYEMMVVTRELDTEFVNLQRQGELALYTPCRGQEAAQVGAAACLRKTD 94 Y DL ++ L LY MV+ R +D E +LQRQGEL L+ RGQEAAQVG+ L D Sbjct: 61 YVADLTDDELFGLYRDMVLVRRMDEEATSLQRQGELGLWASLRGQEAAQVGSGRALGPDD 120 Query: 95 WLFPQYRELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCCAPMSVPIGTQTLHAVGAAM 154 FP YRE GV RG+ P V +RG GG T A S+ +G+QTLHA G AM Sbjct: 121 MAFPSYREHGVAWCRGVDPAAVLAIFRGVNLGGWDPATHGFALYSIVVGSQTLHATGYAM 180 Query: 155 AAQRLDEDSVTVAFLGDGATSEGDVHEALNFAAVFTTPCVFYVQNNQWAISMPVSRQTAA 214 +A+ GDGA+SEGDV+EA +A+V+ P VF+ QNNQWAIS P RQT Sbjct: 181 GMAWDRSAGAAIAYFGDGASSEGDVNEAFGWASVYRAPLVFFCQNNQWAISEPTRRQTRT 240 Query: 215 PSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARARAGDGPTLIEAVTYRLGPHTTADD 274 I H+A G+G P +RVDGNDVLAC AV A A ARAG GP L+EAVTYR+G HTTADD Sbjct: 241 -EIFHRAAGFGFPSVRVDGNDVLACLAVSRWALATARAGRGPVLVEAVTYRMGAHTTADD 299 Query: 275 PTRYRSQEEVDRWATLDPIPRYRTYLQDQGLWSQRLEEQVTARAKHVRSELRDAVFDAPD 334 PTRYRS E++ W+ DP+ R R +L GL + + + A ELR+ D Sbjct: 300 PTRYRSPVELEAWSRRDPLDRMRAHLAACGLLGEERDRHLALEADAFAHELRNRCTAMLD 359 Query: 335 FDVDEVFTTVYAEITPGLQAQREQLRAELARTD 367 D +F V + QR A L +D Sbjct: 360 PDPTSLFDHVQVTENGLVAQQRSAFAATLDPSD 392 Lambda K H 0.320 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 424 Length adjustment: 31 Effective length of query: 336 Effective length of database: 393 Effective search space: 132048 Effective search space used: 132048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory