Align Enoyl-CoA hydratase ACTT3; ACT-toxin biosynthesis protein 3; EC 4.2.1.17 (characterized)
to candidate WP_042441193.1 TX73_RS17555 enoyl-CoA hydratase
Query= SwissProt::Q589W8 (296 letters) >NCBI__GCF_000195775.1:WP_042441193.1 Length = 296 Score = 189 bits (480), Expect = 7e-53 Identities = 109/268 (40%), Positives = 157/268 (58%), Gaps = 20/268 (7%) Query: 22 ADGIAVIVLARSQSRNALTLPMLTDMVQLLSAMDADDSVKCIVFTGEGQFFCSGVDLTEG 81 AD I I L R NA M ++++ DADD+V+ I+ TGEG+ FC+G DL+ G Sbjct: 11 ADQILTITLNRPDKLNAFNPTMQHELIEAFDKADADDNVRAIIVTGEGRAFCAGADLSSG 70 Query: 82 F---------GEIGKTRDTH--------RDAGGKLALAIHNCRKPTIAAINGTAVGVGIT 124 G + + D RD GG++ L I C KP IAA+NG AVG+G+T Sbjct: 71 ADTFDRDARRGPVRRNADGSADYSDPQVRDGGGQVTLRIFKCLKPVIAAVNGPAVGIGVT 130 Query: 125 MTLPMSIRIAAESAKISFPFVRRGIVADAASSFYLPRLIGYGRALHLFTTGALYPAESGL 184 M L M IRIA+E+A+ F F +RGIV +AASS++LPR++G +AL TG ++PA+ L Sbjct: 131 MQLAMDIRIASEAARFGFVFSQRGIVPEAASSWFLPRIVGISQALEWCYTGRVFPAQEAL 190 Query: 185 LHGLFSETVNPASSTLPRALEVARDIAVNASQVGVYLTRDLIYRSLRS--PEQAHLLESA 242 L S V PA L A +A++IA + V V L R +++R + + P +AH ++S Sbjct: 191 EGKLVSRVV-PADQLLDTARTLAKEIAAKTAPVSVALIRQMMWRMMGADDPMEAHKIDSR 249 Query: 243 TLYTRYQSQDFEEGVKSFLEKRRPRFQD 270 +Y R +S D +EGV SFLEKR +F++ Sbjct: 250 GIYERGRSDDVKEGVSSFLEKRPAQFKN 277 Lambda K H 0.320 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 296 Length adjustment: 26 Effective length of query: 270 Effective length of database: 270 Effective search space: 72900 Effective search space used: 72900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory