Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate WP_042441543.1 TX73_RS11560 glutathione S-transferase family protein
Query= reanno::pseudo5_N2C3_1:AO356_16835 (211 letters) >NCBI__GCF_000195775.1:WP_042441543.1 Length = 214 Score = 58.5 bits (140), Expect = 9e-14 Identities = 64/208 (30%), Positives = 94/208 (45%), Gaps = 23/208 (11%) Query: 6 YYRSTSSYRVRIALALKGLDYQALPVNLIAAPGGEHRQPAYLAINPQGRVPALRTDEGAL 65 Y T + +R+ L G Y +N+ A GE RQPAYLAINP G+VPA+R + AL Sbjct: 11 YSPQTRATGMRVLLEELGAPYDLHVLNMKA---GEQRQPAYLAINPLGKVPAIRRGD-AL 66 Query: 66 LVQSPAIIEYLEERYPQVPLL-SADLAVRAHERGVAALIGCDIHPLHNVSVLNQLRQWGH 124 + + AI YL + +P L S D +R A G P +V+++ Q Sbjct: 67 VTEQVAITIYLADLFPGAGLAPSLDDPLRGPYLRWIAYYGSTFEP----AVVDRSMQREP 122 Query: 125 DEAQVTEWIGHWISQG-----LAAVEQLIGDDGYCFGALPGLA-----DVFLIPQLYAAE 174 A+++ + + G LA L+GD L G+A + L+P+ A Sbjct: 123 GPAEMSPYADYDTMLGALEAQLATGPYLLGDRFTAADVLWGIALNWTLNFGLVPKKDAFV 182 Query: 175 RFNVSLQGYPRIRRV----AALAAVHPA 198 R+ + P RRV A +AA H A Sbjct: 183 RYAELVTARPAFRRVDLADAEMAAEHAA 210 Lambda K H 0.321 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 214 Length adjustment: 21 Effective length of query: 190 Effective length of database: 193 Effective search space: 36670 Effective search space used: 36670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory