Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate WP_042615044.1 ABB28_RS00970 carbohydrate ABC transporter permease
Query= uniprot:A3DHA2 (303 letters) >NCBI__GCF_001431535.1:WP_042615044.1 Length = 278 Score = 167 bits (423), Expect = 3e-46 Identities = 95/277 (34%), Positives = 160/277 (57%), Gaps = 21/277 (7%) Query: 30 LIVITVVLLFPILFTIANSFMSDKEVLDTYQKKIEEVEEGESTEFLGFKLIPDMVSMKQY 89 L+V+ +V L P+L+ ++ S M GE+T F L P V+ Y Sbjct: 19 LLVLALVSLAPLLWMVSVSVMP----------------AGEATTFPP-PLTPSHVTFANY 61 Query: 90 YTVLFRKPTFLLMFLNSAIMTIPIVIIQVIVGVFAAYAFAKLRFPLRDKLFFVFIVVMLM 149 + LF + + F NS ++++ I + +++ A YAFAKLRF RD+LF V + +++ Sbjct: 62 HE-LFARTGMGVNFANSLLVSVAITLGSLLLNTMAGYAFAKLRFVGRDRLFQVLMAALVI 120 Query: 150 PLQVTLVPNYILLRKLDMIGSFLSVILPGGFSAFGVVLLRQYMRGIPDECCEAAMIDGAG 209 P QV ++P ++L+++L ++ SF VI+P + FG+ L+RQY R IPDE EAA +DGAG Sbjct: 121 PAQVAMLPLFLLMKQLGLVNSFGGVIVPALATVFGIFLVRQYARSIPDELLEAARMDGAG 180 Query: 210 YLKTFTKIILPQCKSIIASLAILAFIDNWNMVEQPLIFLSDSAKYPLSVYLAYINEG--- 266 ++ F +I+LP K ++ +L+I F+ WN PLI L+D Y L V LA ++ Sbjct: 181 EMRIFFQIVLPMLKPVLVTLSIFTFMGAWNDFMWPLIVLTDQEHYTLPVALATLSREHIM 240 Query: 267 DLGLAFASGVLYMIPTVLIYLYGEKYFVEGIQLTGIK 303 D+ + A V+ +IP + ++L ++Y+++G+ L +K Sbjct: 241 DVEMMMAGAVVTVIPVLALFLLLQRYYIQGLMLGSVK 277 Lambda K H 0.331 0.147 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 278 Length adjustment: 26 Effective length of query: 277 Effective length of database: 252 Effective search space: 69804 Effective search space used: 69804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory