Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate WP_042615044.1 ABB28_RS00970 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21219 (281 letters) >NCBI__GCF_001431535.1:WP_042615044.1 Length = 278 Score = 129 bits (324), Expect = 7e-35 Identities = 84/280 (30%), Positives = 147/280 (52%), Gaps = 10/280 (3%) Query: 4 QSPLFSVFIHASALLLAVVILAPVAWLLIMSISPAADLSAKPLAWWPSDIDLSRYRTLLS 63 QS +I+ L+LA+V LAP+ W++ +S+ PA + + P PS + + Y L + Sbjct: 7 QSRWHGWWINGGLLVLALVSLAPLLWMVSVSVMPAGEATTFPPPLTPSHVTFANYHELFA 66 Query: 64 AVENSAGAAFIASLLNSIKVAGMATLAAVVVAVPAAWAVSRTPAVAWS--LYAVIATYML 121 G F SLL S+ + TL ++++ A +A ++ V ++A ++ Sbjct: 67 --RTGMGVNFANSLLVSVAI----TLGSLLLNTMAGYAFAKLRFVGRDRLFQVLMAALVI 120 Query: 122 PPVALAVPLYMGLAYFGLLNSVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMIDG 181 P +PL++ + GL+NS G+ + L + F +L++ SIP E+ AA +DG Sbjct: 121 PAQVAMLPLFLLMKQLGLVNSFGGVIVPALATV--FGIFLVRQYARSIPDELLEAARMDG 178 Query: 182 ARLDQILRILTLPLAAPVMATSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGGR 241 A +I + LP+ PV+ T ++F F+ AW++F + L+ +DQ TL VA+A L+ Sbjct: 179 AGEMRIFFQIVLPMLKPVLVTLSIFTFMGAWNDFMWPLIVLTDQEHYTLPVALATLSREH 238 Query: 242 VSDYGLIATAGVLAALPPVLIGLIMQRALISGLTSGGVKG 281 + D ++ V+ +P + + L++QR I GL G VKG Sbjct: 239 IMDVEMMMAGAVVTVIPVLALFLLLQRYYIQGLMLGSVKG 278 Lambda K H 0.325 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 278 Length adjustment: 26 Effective length of query: 255 Effective length of database: 252 Effective search space: 64260 Effective search space used: 64260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory