Align ABC transporter for Lactose, permease component 2 (characterized)
to candidate WP_042615044.1 ABB28_RS00970 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21654 (272 letters) >NCBI__GCF_001431535.1:WP_042615044.1 Length = 278 Score = 166 bits (421), Expect = 4e-46 Identities = 85/261 (32%), Positives = 152/261 (58%), Gaps = 3/261 (1%) Query: 15 GFLGLMAFLSVFPFIWMVLGATNSSIDI--IKGKLLPGAAFATNVANFFTLVNVPLVFWN 72 G L ++A +S+ P +WMV + + + L P N F + + F N Sbjct: 17 GGLLVLALVSLAPLLWMVSVSVMPAGEATTFPPPLTPSHVTFANYHELFARTGMGVNFAN 76 Query: 73 SAKIAIVATVLTLAVSSLAGYGFEMFRSRRRERVYRAMLLTLMIPFAALMIPLFVMMGKA 132 S +++ T+ +L ++++AGY F R R+R+++ ++ L+IP M+PLF++M + Sbjct: 77 SLLVSVAITLGSLLLNTMAGYAFAKLRFVGRDRLFQVLMAALVIPAQVAMLPLFLLMKQL 136 Query: 133 GLINTHLAVVLPSIGSAFVIFYFRQSTKAFPSELRDAAKVDGLKEWQIFLFIYVPVMRST 192 GL+N+ V++P++ + F IF RQ ++ P EL +AA++DG E +IF I +P+++ Sbjct: 137 GLVNSFGGVIVPALATVFGIFLVRQYARSIPDELLEAARMDGAGEMRIFFQIVLPMLKPV 196 Query: 193 YAAAFVIVFMTAWNNYLWPLIVLQTNETKTITLVISSLASAYYPDYGVVMVGTILATLPT 252 + FM AWN+++WPLIVL E T+ + +++L+ + D ++M G ++ +P Sbjct: 197 LVTLSIFTFMGAWNDFMWPLIVLTDQEHYTLPVALATLSREHIMDVEMMMAGAVVTVIPV 256 Query: 253 LAVFFFMQRQFVQG-MLGSVK 272 LA+F +QR ++QG MLGSVK Sbjct: 257 LALFLLLQRYYIQGLMLGSVK 277 Lambda K H 0.331 0.141 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 278 Length adjustment: 25 Effective length of query: 247 Effective length of database: 253 Effective search space: 62491 Effective search space used: 62491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory