Align GlcU, component of Glucose, mannose, galactose porter (characterized)
to candidate WP_042615044.1 ABB28_RS00970 carbohydrate ABC transporter permease
Query= TCDB::Q97UY9 (287 letters) >NCBI__GCF_001431535.1:WP_042615044.1 Length = 278 Score = 120 bits (302), Expect = 3e-32 Identities = 83/269 (30%), Positives = 137/269 (50%), Gaps = 22/269 (8%) Query: 16 LALAIVSV---IWLIPVYAMLINGFKSNFEVLSTPVLVPPTKITFEAYVSVLL--SLAKP 70 L LA+VS+ +W++ V M E + P + P+ +TF Y + + Sbjct: 20 LVLALVSLAPLLWMVSVSVMPAG------EATTFPPPLTPSHVTFANYHELFARTGMGVN 73 Query: 71 LINSLIIVIPTSFISAFLGAMGAYFFYTLSYSFSRASSAISDVLFSLISLATFIPQEATL 130 NSL++ + + S L M Y F L + D LF ++ A IP + + Sbjct: 74 FANSLLVSVAITLGSLLLNTMAGYAFAKLRF-------VGRDRLFQVLMAALVIPAQVAM 126 Query: 131 LPLTRLIVSMGLLDSYIGIIFALLIFYIPTGALLMSMFISVIPRSLIEAAKMDGTGDLKI 190 LPL L+ +GL++S+ G+I L G L+ + IP L+EAA+MDG G+++I Sbjct: 127 LPLFLLMKQLGLVNSFGGVIVPALATVF--GIFLVRQYARSIPDELLEAARMDGAGEMRI 184 Query: 191 FMKIVFPLSMPGFISTLIFIIIQAWNNFFIPLVLVTTPGMKLTSIAVLSYSGAYGTLYND 250 F +IV P+ P ++ IF + AWN+F PL+++T +A+ + S + + + Sbjct: 185 FFQIVLPMLKPVLVTLSIFTFMGAWNDFMWPLIVLTDQEHYTLPVALATLSREH-IMDVE 243 Query: 251 TFAAGMVASIIP-LAIFVFLGRYFIRGLM 278 AG V ++IP LA+F+ L RY+I+GLM Sbjct: 244 MMMAGAVVTVIPVLALFLLLQRYYIQGLM 272 Lambda K H 0.330 0.144 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 278 Length adjustment: 26 Effective length of query: 261 Effective length of database: 252 Effective search space: 65772 Effective search space used: 65772 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory