Align ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized)
to candidate WP_042615044.1 ABB28_RS00970 carbohydrate ABC transporter permease
Query= TCDB::G4FGN6 (278 letters) >NCBI__GCF_001431535.1:WP_042615044.1 Length = 278 Score = 158 bits (400), Expect = 1e-43 Identities = 87/264 (32%), Positives = 155/264 (58%), Gaps = 5/264 (1%) Query: 15 VVLILIWCVFPLYWAFISSIKPDRDLFEKNPSLFPKRITFENYVKVFKERPFHINIKNSI 74 +VL L+ + PL W S+ P + P L P +TF NY ++F +N NS+ Sbjct: 20 LVLALV-SLAPLLWMVSVSVMPAGEATTFPPPLTPSHVTFANYHELFARTGMGVNFANSL 78 Query: 75 IVAGITTVLALVVGSLAGYAIARLKFRGKVIVMSLILAVSMFPQVSILGSLFLILRGLKL 134 +V+ T+ +L++ ++AGYA A+L+F G+ + +++A + P + LFL+++ L L Sbjct: 79 LVSVAITLGSLLLNTMAGYAFAKLRFVGRDRLFQVLMAALVIPAQVAMLPLFLLMKQLGL 138 Query: 135 INTYTGLIIPYTAMNLPLTVWVLQSFFRELPKEVEESAFIDGASKLRTLWSIVLPMSAPG 194 +N++ G+I+P A+ +++++ + R +P E+ E+A +DGA ++R + IVLPM P Sbjct: 139 VNSFGGVIVP--ALATVFGIFLVRQYARSIPDELLEAARMDGAGEMRIFFQIVLPMLKPV 196 Query: 195 LVATGLLTFIAAWNEFLFALTFMQKPSLYTVPVAVALFKGASQYEIPWGQLMAAAVIVTL 254 LV + TF+ AWN+F++ L + YT+PVA+A + ++ + +MA AV+ + Sbjct: 197 LVTLSIFTFMGAWNDFMWPLIVLTDQEHYTLPVALATL--SREHIMDVEMMMAGAVVTVI 254 Query: 255 PLVILVLVFQNRIIAGLSAGAVKG 278 P++ L L+ Q I GL G+VKG Sbjct: 255 PVLALFLLLQRYYIQGLMLGSVKG 278 Lambda K H 0.329 0.142 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 278 Length adjustment: 25 Effective length of query: 253 Effective length of database: 253 Effective search space: 64009 Effective search space used: 64009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory