Protein WP_043458116.1 in Azohydromonas australica DSM 1124
Annotation: NCBI__GCF_000430725.1:WP_043458116.1
Length: 331 amino acids
Source: GCF_000430725.1 in NCBI
Candidate for 35 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| xylitol catabolism | Dshi_0546 | med | ABC transporter for Xylitol, ATPase component (characterized) | 41% | 91% | 225.7 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-sorbitol (glucitol) catabolism | mtlK | med | ABC transporter for D-Sorbitol, ATPase component (characterized) | 43% | 80% | 218.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| N-acetyl-D-glucosamine catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 40% | 83% | 216.5 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-glucosamine (chitosamine) catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 40% | 83% | 216.5 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| lactose catabolism | lacK | med | LacK, component of Lactose porter (characterized) | 42% | 79% | 210.3 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| sucrose catabolism | thuK | lo | ABC transporter (characterized, see rationale) | 45% | 62% | 220.7 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-maltose catabolism | malK | lo | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 43% | 69% | 218.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 47% | 65% | 217.6 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| trehalose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 47% | 65% | 217.6 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 49% | 64% | 215.7 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-cellobiose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 40% | 82% | 211.8 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-glucose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 40% | 82% | 211.8 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| lactose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 40% | 82% | 211.8 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-maltose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 40% | 82% | 211.8 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| sucrose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 40% | 82% | 211.8 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| trehalose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 40% | 82% | 211.8 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 40% | 82% | 211.8 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-mannose catabolism | TT_C0211 | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 40% | 90% | 211.5 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| L-arabinose catabolism | xacK | lo | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 47% | 63% | 208 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-maltose catabolism | malK_Aa | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 46% | 62% | 206.8 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-maltose catabolism | malK_Sm | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 39% | 80% | 206.1 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| trehalose catabolism | malK | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 39% | 80% | 206.1 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-cellobiose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 39% | 79% | 191.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-glucose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 39% | 79% | 191.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| lactose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 39% | 79% | 191.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-maltose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 39% | 79% | 191.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| D-maltose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 39% | 79% | 191.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| sucrose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 39% | 79% | 191.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| sucrose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 39% | 79% | 191.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| trehalose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 39% | 79% | 191.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| trehalose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 39% | 79% | 191.4 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| L-proline catabolism | proV | lo | glycine betaine/l-proline transport atp-binding protein prov (characterized) | 35% | 68% | 171 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| L-proline catabolism | opuBA | lo | BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) | 39% | 72% | 169.1 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| L-histidine catabolism | hutV | lo | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 36% | 84% | 157.5 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
| L-proline catabolism | hutV | lo | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 36% | 84% | 157.5 | Uncharacterized ABC transporter ATP-binding protein YdcT | 44% | 241.5 |
Sequence Analysis Tools
View WP_043458116.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSTDLAHLELVALSKRYGPGTPAVDAIDLQVRAGSYCCLLGPSGCGKTTTLRMIAGHEVA
TEGDILLGARNITDLDATQRGTAMMFQSYALFPHLNALDNVAFGLKMRGVDAATRRARAA
ELLDLVAMGAYAQRKPGELSGGQQQRVALARALITNPKVLLLDEPLSALDPFLRVKMRAE
LKRWQKDLGFSFVHVTHSQEEAMALADQVVVMNAGRIEQQGTPHQIFNAPRTEFVARFMG
GHNVLPAGSAKVAVRSDRTLLTRGAASAGEGLAATVQNVEYQGTYVLVTLASNAGEVAAM
LPEGAFDVAPWAPGEAATVSWLPAHAHALQA
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory