Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_043459715.1 H537_RS0123965 enoyl-CoA hydratase
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_000430725.1:WP_043459715.1 Length = 256 Score = 203 bits (517), Expect = 2e-57 Identities = 106/242 (43%), Positives = 155/242 (64%) Query: 14 LLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFAAGADLNEMAEKDL 73 ++T++RP RNALN A+ +V +L A + +++ V+TG +F AG D+ EMA Sbjct: 15 IVTIDRPERRNALNLAVKQAIVQQLHALVANDAVAAIVLTGAGGYFVAGTDIAEMAGMRP 74 Query: 74 AATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAGENARFGLPEITLG 133 + +++ +++ KP+IAAV GYALG GCELAL CDV+VA E+A FG PEI +G Sbjct: 75 MDHVRLATDEVFHVVRSSGKPVIAAVEGYALGGGCELALACDVIVAAEDACFGQPEIKVG 134 Query: 134 IMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSDLTLEYALQLASK 193 IMPGAGGTQRL+RS G+ + L+G+ I A+ A A +VS + P L A Q+ + Sbjct: 135 IMPGAGGTQRLLRSAGRYKTALWALTGDMIPAKDAYAANMVSQLVPKGQALARAQQIGEQ 194 Query: 194 MARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEGISAFLQKRTPDFK 253 +A PLA+Q ++ LRQ +V L+ LA ER++F L +ED+ EG+ AFL+KR P ++ Sbjct: 195 IAAMPPLAVQGIREVLRQGADVPLETALALERRVFERLFDSEDQKEGMQAFLEKRKPSYR 254 Query: 254 GR 255 GR Sbjct: 255 GR 256 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 256 Length adjustment: 24 Effective length of query: 231 Effective length of database: 232 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory