Align Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 (characterized)
to candidate WP_043769320.1 U743_RS14940 diaminopimelate epimerase
Query= SwissProt::P0A6K1 (274 letters) >NCBI__GCF_000733765.1:WP_043769320.1 Length = 286 Score = 251 bits (640), Expect = 2e-71 Identities = 141/282 (50%), Positives = 173/282 (61%), Gaps = 19/282 (6%) Query: 1 MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60 ++FSKMHGLGNDF+VVDA Q S E + L DRH GVG DQ+LVV+PP E DF Y Sbjct: 5 LRFSKMHGLGNDFVVVDATRQAFAPSTEQLAWLCDRHFGVGADQVLVVDPPAGDE-DFGY 63 Query: 61 RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120 RI+NADGS QCGNGARC F+ +GL++K + V T++ RM + DD V + Sbjct: 64 RIYNADGSRSGQCGNGARCLGLFIHGQGLSDKDRLSVRTSDTRMHIARCDDADYEVELAP 123 Query: 121 PNFEPSAVPFRANKAEKTYIMRAAEQTI--------LCGVVSMGNPHCVIQVDDVDTAAV 172 P EP+A+P R + A AAE + G+V +GNPH V+ VDDVDT V Sbjct: 124 PVLEPAALPSRLDAAP------AAEHELEVPGFGLLRVGLVQLGNPHAVLLVDDVDTTPV 177 Query: 173 ETLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQG 232 LG L++ FP N+GF+Q+ R RLRVYERGAGET ACGSGACAA + +G Sbjct: 178 AELGAALQALPLFPASVNVGFLQMQGRGEGRLRVYERGAGETLACGSGACAAAVSAVLRG 237 Query: 233 LLAEEVRVELPGGRLDIAWKG----PGHPLYMTGPAVHVYDG 270 L E V +EL GG L IAW G P P+ M GPA HVYDG Sbjct: 238 LADEAVTLELRGGSLHIAWSGSLSSPQSPVRMRGPATHVYDG 279 Lambda K H 0.323 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 286 Length adjustment: 26 Effective length of query: 248 Effective length of database: 260 Effective search space: 64480 Effective search space used: 64480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
Align candidate WP_043769320.1 U743_RS14940 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
../bin/blast/fastacmd -i /tmp/list.9399.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.9399.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.