Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate WP_043772115.1 U743_RS12665 aminodeoxychorismate/anthranilate synthase component II
Query= BRENDA::P20576 (201 letters) >NCBI__GCF_000733765.1:WP_043772115.1 Length = 198 Score = 286 bits (732), Expect = 2e-82 Identities = 133/190 (70%), Positives = 161/190 (84%) Query: 1 MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAG 60 M+L++DNYDSFTYNLVQY GE+ A+V+VVRND +SV+++ A P+ I+LSPGPCTPNEAG Sbjct: 1 MVLVVDNYDSFTYNLVQYLGEIGAQVEVVRNDAMSVDEMLARQPDHILLSPGPCTPNEAG 60 Query: 61 VSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLAN 120 V L +IER AG +P+ GVCLGHQ+IGQ FGGEVVRAR+VMHGKTS IHH +GVFAGL + Sbjct: 61 VCLELIERAAGHIPIFGVCLGHQAIGQVFGGEVVRAREVMHGKTSAIHHTGVGVFAGLES 120 Query: 121 PLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTE 180 PLT TRYHSL+V R+SLP+CLE+TAWT ADG +DE+MG RH+ L VEGVQFHPESIL+E Sbjct: 121 PLTATRYHSLIVARDSLPDCLELTAWTATADGGVDEVMGFRHRELAVEGVQFHPESILSE 180 Query: 181 QGHELLANFL 190 GH +L FL Sbjct: 181 HGHAMLRTFL 190 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 198 Length adjustment: 21 Effective length of query: 180 Effective length of database: 177 Effective search space: 31860 Effective search space used: 31860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate WP_043772115.1 U743_RS12665 (aminodeoxychorismate/anthranilate synthase component II)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
../bin/blast/fastacmd -i /tmp/list.22257.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.22257.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.