Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate WP_043827862.1 RSPH17029_RS00115 acetyl-CoA C-acyltransferase family protein
Query= metacyc::MONOMER-3207 (400 letters) >NCBI__GCF_000015985.1:WP_043827862.1 Length = 389 Score = 339 bits (870), Expect = 7e-98 Identities = 195/400 (48%), Positives = 255/400 (63%), Gaps = 11/400 (2%) Query: 1 MRDVFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQA 60 M D+ + A+RT IG FGGALA V DLA +A +E V+ +V V FG Sbjct: 1 MSDILVLSAVRTAIGGFGGALAAVPPGDLATTVTRAALE-RAGVEPGRVGHVVFGHVINT 59 Query: 61 GEDNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESM 120 + ++R+A + AG+P +P + +NRLC SG+ AI +A +A+ G+ E+A+AGG ESM Sbjct: 60 EPRDMYLSRVAAMQAGIPSEVPAMNVNRLCGSGVQAIVSAMQALMLGDAEVALAGGAESM 119 Query: 121 SRAPFVMGKAESGYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRAD 180 SRAP+ + A G K+ DT + + +G M TA+ VA+ + +SR D Sbjct: 120 SRAPYALTTARWG----QKMGDTR-ALDMMTGALNCPFGTGHMGITAEIVAERHGISRED 174 Query: 181 QDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGETIVERDEHLRPETTLEALTKLKPV 240 QDAFAL SQ + A AQ G F +IVPV IA +KG RDEH + TTLEAL L+P Sbjct: 175 QDAFALESQTRTARAQEEGRFDGQIVPVEIASRKGPVSFSRDEHPKA-TTLEALAGLRPA 233 Query: 241 NGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPVP 300 TVTAGNASG+NDGA ALILA AV G P R++G A GV P VMG+GP+P Sbjct: 234 FQKGGTVTAGNASGINDGAGALILAREGAVP--GARPLGRLIGYAHAGVDPEVMGLGPIP 291 Query: 301 AVRKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLGM 360 AV+ L R G++V+DFDVIE NEAFA+Q LAV R L D +VNPNGGAIALGHP+G Sbjct: 292 AVQALCARTGLSVADFDVIESNEAFAAQALAVARALDF--DPARVNPNGGAIALGHPVGA 349 Query: 361 SGARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIERV 400 +GA + + ALH+L ++GGR+ L TMC+G GQG+ALA+ERV Sbjct: 350 TGAIITVKALHELHRTGGRRALVTMCIGGGQGIALALERV 389 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 389 Length adjustment: 31 Effective length of query: 369 Effective length of database: 358 Effective search space: 132102 Effective search space used: 132102 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory