Align Alpha-glucosidase; EC 3.2.1.- (characterized, see rationale)
to candidate WP_043828307.1 RSPH17029_RS13100 alpha-amylase family protein
Query= uniprot:A8LLL3 (552 letters) >NCBI__GCF_000015985.1:WP_043828307.1 Length = 548 Score = 240 bits (613), Expect = 9e-68 Identities = 165/519 (31%), Positives = 236/519 (45%), Gaps = 45/519 (8%) Query: 19 WWRGAVIYQIYPRSFQDSNGDGIGDLLGIVERMPYIASLGVDAIWISPFFTSPMKDFGYD 78 WW+ AV Y + +FQDSNGDGIGD G+ R+ ++ LGV IW+ PF+ SP +D GYD Sbjct: 10 WWKNAVFYCLDVETFQDSNGDGIGDFAGLTRRLDHLDRLGVSCIWLMPFYPSPNQDDGYD 69 Query: 79 ISDYFDVDPMFGSLADFDALIETAHMYGLRVMIDLVLSHTSDQHPWFEESRSSRDNPKAD 138 I+DY+ VDP G+L DF + AH G+RV+ DLV++HTS +HPWF+ SR+ D+P D Sbjct: 70 ITDYYSVDPRLGTLGDFVEFLRAAHDRGMRVIADLVVNHTSREHPWFQASRADPDSPYRD 129 Query: 139 WYVWADAKPDGTPPNNWLSIFGGSGWHWDARRCQYYLHNFLTSQPDLNFHCADVQDALLG 198 WYVW D KP+ + S W WDA+ +YYLH F + QPDLN V+D + Sbjct: 130 WYVWRDEKPEEDAASLVFPGEENSSWTWDAKAGKYYLHRFYSHQPDLNVENRAVRDEIQR 189 Query: 199 VGRFWLDRGVDGFRLDTINFYVHDAELRDNPPLPPE---------ERNSN---IAPEVN- 245 + FWL G+ GFR+D + F + D P R S + EVN Sbjct: 190 IVGFWLQLGLSGFRVDAVPFLLEQMSTVDTGFAPHRWLRDLRAFINRRSGDAVLLGEVNL 249 Query: 246 PYNHQRHLYSKNQPENLEFLAKFRAMMEEYPAIAAVGE-VGDAQYGLEILGQYTRGETGV 304 Y R + + L F + + A+A E G +GL + + + Sbjct: 250 DYPDVRRFFGDEDGDELHMCLDFN--LNQAMALALAREDAGPIVHGLRHMPELAPDDGWA 307 Query: 305 HMCYAFEFLAQEKLTAKRVAEVLNKVDEVASDGWACWAFSNHDVMRHVSRWDLTPGAQRG 364 H + + +KLT EV S F R + P R Sbjct: 308 HFLRNHDEWSLDKLTEAERQEVFASFGPDPS----MQLFGRGLRRRMPTMLKGNPDRLRM 363 Query: 365 MLTLLMCLRGSVCLYQGEELGLPEAEVAFDDLQDPYGIEFWPEYKGRDGCRTPMVWQSDN 424 L+ + GS ++ GEE+G+ E +L+ P GR R PM W + Sbjct: 364 AYALMASMPGSPVIFYGEEIGMAE------NLEIP----------GRLAVRAPMQWDA-G 406 Query: 425 MSGGFS------IHRPWLPVSTEHLGLAVAV-QEEAPDALLHHYRRALAFRRAHPALVKG 477 GGFS +HRP + G A+ Q++ PD + H L RR P + G Sbjct: 407 PHGGFSNASTEALHRPMVSDPQWGPGKVNAIDQQDRPDTMFHFMEHLLRRRRECPEIAFG 466 Query: 478 DISDVTVVGDVISFLRKDPEETVFVAI-NMSDAPGAVDL 515 + + + I +R D E +A+ N+ P V L Sbjct: 467 EHAVLPFPEPEIFAIRHDWESRTLIALANLGAKPQKVTL 505 Lambda K H 0.321 0.138 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 968 Number of extensions: 55 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 552 Length of database: 548 Length adjustment: 36 Effective length of query: 516 Effective length of database: 512 Effective search space: 264192 Effective search space used: 264192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory