Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_043879632.1 AZC_RS20025 acetyl-CoA C-acyltransferase
Query= BRENDA::P45359 (392 letters) >NCBI__GCF_000010525.1:WP_043879632.1 Length = 393 Score = 406 bits (1043), Expect = e-118 Identities = 200/389 (51%), Positives = 273/389 (70%) Query: 2 KEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIKPEDVNEVILGNVLQAGL 61 +++VIA VRTAIG+Y +LK PA DLGA ++E V++AG+ P V V++GNV+QAG Sbjct: 3 RDIVIAHPVRTAIGAYNGTLKGTPATDLGAVVVRETVRRAGLDPAAVGSVVMGNVIQAGN 62 Query: 62 GQNPARQASFKAGLPVEIPAMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSRA 121 NPARQAS GLPVE+PAMT+N+VCGSG + V AA I +G DV +AGGMENM RA Sbjct: 63 RMNPARQASIHGGLPVEVPAMTVNRVCGSGAQAVVTAALEIASGLHDVAVAGGMENMDRA 122 Query: 122 PYLANNARWGYRMGNAKFVDEMITDGLWDAFNDYHMGITAENIAERWNISREEQDEFALA 181 PYL + RWGYRMG A+ +D M+TDGL DAF+ H G E++ R I+R EQD FA Sbjct: 123 PYLMDGGRWGYRMGPAQILDSMLTDGLNDAFSGSHSGWHTEDLVARSQITRAEQDAFAAR 182 Query: 182 SQKKAEEAIKSGQFKDEIVPVVIKGRKGETVVDTDEHPRFGSTIEGLAKLKPAFKKDGTV 241 SQ++ A G+F +EIV V +KGRKG + DE PR +T+E LA+L+PAF+ +GT+ Sbjct: 183 SQQRFAAAQAEGRFTEEIVAVEVKGRKGIELFSVDEAPRPDTTVETLARLRPAFRPEGTI 242 Query: 242 TAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAAIE 301 TAGNA GLN AA +++ A++ G+ PL ++ +G AGV+P + G GP A + A++ Sbjct: 243 TAGNAPGLNSAAAAMIVAERAFAEKSGIAPLGRLAGFGIAGVEPGLFGLGPVPAVRKALQ 302 Query: 302 KAGWTVDELDLIESNEAFAAQSLAVAKDLKFDMNKVNVNGGAIALGHPIGASGARILVTL 361 AGW++ +++ IE NEAFAA +AVA++L + VNV GGA+A GHPIGA+GA ++ L Sbjct: 303 HAGWSLGDIERIEINEAFAAVPIAVARELGLPEDIVNVEGGAVAHGHPIGATGAILVTRL 362 Query: 362 VHAMQKRDAKKGLATLCIGGGQGTAILLE 390 +HAM++ K+G+ TLCIGGGQG A+ LE Sbjct: 363 LHAMKRDGVKRGVVTLCIGGGQGIALALE 391 Lambda K H 0.315 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 393 Length adjustment: 31 Effective length of query: 361 Effective length of database: 362 Effective search space: 130682 Effective search space used: 130682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_043879632.1 AZC_RS20025 (acetyl-CoA C-acyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.8776.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-133 430.2 2.7 4e-133 430.0 2.7 1.0 1 lcl|NCBI__GCF_000010525.1:WP_043879632.1 AZC_RS20025 acetyl-CoA C-acyltra Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000010525.1:WP_043879632.1 AZC_RS20025 acetyl-CoA C-acyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 430.0 2.7 4e-133 4e-133 2 385 .] 8 391 .. 7 391 .. 0.98 Alignments for each domain: == domain 1 score: 430.0 bits; conditional E-value: 4e-133 TIGR01930 2 vdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaagl 70 vRt+ig+++g+lk ++a dL+a v++e ++ragldp+++ v++Gnv+qag+ +n+aR+a + gl lcl|NCBI__GCF_000010525.1:WP_043879632.1 8 AHPVRTAIGAYNGTLKGTPATDLGAVVVRETVRRAGLDPAAVGSVVMGNVIQAGNRMNPARQASIHGGL 76 5669*****99********************************************************** PP TIGR01930 71 pesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledq 139 p +vpa+tvnrvC+Sg qAv +aa +i++G dv+vaGG+E+m r+p+l++ r+++++g a+ d+ lcl|NCBI__GCF_000010525.1:WP_043879632.1 77 PVEVPAMTVNRVCGSGAQAVVTAALEIASGLHDVAVAGGMENMDRAPYLMDGG--RWGYRMGPAQILDS 143 **************************************************997..9************* PP TIGR01930 140 llkdl...vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk..kk 203 +l d+ + ++ + g ++e l ++ +i+R eqD++a+rS+q+ a+A++eg+f +eiv vevkg+ + lcl|NCBI__GCF_000010525.1:WP_043879632.1 144 MLTDGlndAFSGSHSGWHTEDLVARSQITRAEQDAFAARSQQRFAAAQAEGRFTEEIVAVEVKGRkgIE 212 *****99988999***************************************************99999 PP TIGR01930 204 vvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsa 272 +s De +rp+tt+e+La+L+paf+ ++g t+tAgN+ +ln +Aaa++++++++a++ g+ pl+r+ ++ lcl|NCBI__GCF_000010525.1:WP_043879632.1 213 LFSVDEAPRPDTTVETLARLRPAFR-PEG-TITAGNAPGLNSAAAAMIVAERAFAEKSGIAPLGRLAGF 279 9***********************9.59*.6************************************** PP TIGR01930 273 avagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAl 341 ++agv+p +glgpvpA++kaL++ag+s+ di+ +EinEAFAa+ +av++elg l ++ vNv GGA+A lcl|NCBI__GCF_000010525.1:WP_043879632.1 280 GIAGVEPGLFGLGPVPAVRKALQHAGWSLGDIERIEINEAFAAVPIAVARELG-LPEDIVNVEGGAVAH 347 *****************************************************.88************* PP TIGR01930 342 GHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 GHP+Ga+Ga++v++ll+++k++g+k+G++tlC+ggGqG+A+ le lcl|NCBI__GCF_000010525.1:WP_043879632.1 348 GHPIGATGAILVTRLLHAMKRDGVKRGVVTLCIGGGQGIALALE 391 ****************************************9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.26 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory