Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate WP_044136943.1 TERY_RS19640 1,4-dihydroxy-2-naphthoyl-CoA synthase
Query= reanno::psRCH2:GFF2389 (257 letters) >NCBI__GCF_000014265.1:WP_044136943.1 Length = 282 Score = 113 bits (282), Expect = 5e-30 Identities = 89/264 (33%), Positives = 121/264 (45%), Gaps = 16/264 (6%) Query: 3 FETLLVDIQERVALITLNRPQALNALNGQLISELNQALGQLEADPQIGCIVLTGSAK--- 59 + +L + +A IT+NRP NA + + EL A DP IG ++LTG+ Sbjct: 16 YNDILYHKTDGIAKITINRPHKRNAFRPKTVFELYDAFVDAREDPNIGVVLLTGAGPHKD 75 Query: 60 ---AFAAGADIKEMAELTY------PQIYLDDFFADADRIATRRKPLIAAVAGYALGGGC 110 AF +G D Y P++ + D I + K +IA VAGYA+GGG Sbjct: 76 GKYAFCSGGDQSVRGTAGYVDEAGVPRLNVLDL---QRLIRSMPKVVIALVAGYAIGGGH 132 Query: 111 ELALLCDMIFAADNARFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEA 170 L ++CD+ AADNA FGQ +G G G L R VG+ KA ++ RQ A +A Sbjct: 133 VLHIICDLTIAADNAIFGQTGPKVGSFDGGFGASYLARIVGQKKAREIWFLCRQYTAEQA 192 Query: 171 ERAGLVARVFPAESLLEETLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVF 230 GLV V P E L E +K A I KS A +K + N + A Sbjct: 193 LDMGLVNCVVPVEELETEGIKWAFEILAKSPIAIRCLKAAFNADCDGQ-AGLQELAGNAT 251 Query: 231 HAVFATADQKEGMAAFSEKRKPEF 254 + T + EG AF EKR P+F Sbjct: 252 LLYYMTEEGAEGKKAFLEKRSPDF 275 Lambda K H 0.321 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 282 Length adjustment: 25 Effective length of query: 232 Effective length of database: 257 Effective search space: 59624 Effective search space used: 59624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory