Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_046008443.1 OLEAN_RS05785 3-oxoacyl-ACP reductase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_000967895.1:WP_046008443.1 Length = 256 Score = 117 bits (293), Expect = 2e-31 Identities = 78/250 (31%), Positives = 133/250 (53%), Gaps = 8/250 (3%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKY--PGTVAT--RADVS 67 G +I+G A GIG A + GA+V + D+++ A RD+ G VA + + Sbjct: 6 GKVAVITGAALGIGGATALLLAKEGAKVAITDINDEAGMNLRDEIITAGGVAQYWHLNTA 65 Query: 68 DAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHH 127 D ++ VF G +D+LVNNAGIAG I+ EW+A +NIN+T + + Sbjct: 66 DEDNVKDVFAKVFSEFGSIDILVNNAGIAGANKPTHEITKQEWEAVMNINVTGVFLCTKY 125 Query: 128 AVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALL 187 A+P LK++S G +++++S+ G +G A PY A+K A+ + K+ A + +IRVN++ Sbjct: 126 AIPYLKKASSGSIINLSSIYGLVGAADLPPYHASKGAVRLMSKNDALIYAKDNIRVNSVH 185 Query: 188 PGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARN 247 PG + P + + E G + + + L+ I + +D+A+ L+L S ++ Sbjct: 186 PGFIWTPLVAALAADSPE--GSEAFKAKLDSLHPIG--HVGAPDDIASGILYLASDESKF 241 Query: 248 VTGQAISVDG 257 VTG + +DG Sbjct: 242 VTGTELVIDG 251 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 256 Length adjustment: 24 Effective length of query: 238 Effective length of database: 232 Effective search space: 55216 Effective search space used: 55216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory