Align Ornithine carbamoyltransferase 1, anabolic; OTCase 1; Ornithine carbamoyltransferase 1, phaseolotoxin-sensitive; SOCT; EC 2.1.3.3 (characterized)
to candidate WP_046008543.1 OLEAN_RS06400 ornithine carbamoyltransferase
Query= SwissProt::Q02047 (306 letters) >NCBI__GCF_000967895.1:WP_046008543.1 Length = 302 Score = 411 bits (1056), Expect = e-119 Identities = 197/297 (66%), Positives = 240/297 (80%) Query: 3 ARHFLSMMDYTPDELLGLIRRGVELKDLRIRGELFEPLKNRVLGMIFEKSSTRTRLSFEA 62 ARHFL+++D P EL +I R +ELK ++ GE++EPLKN+VLGMIFEKSSTRTR+SFEA Sbjct: 2 ARHFLTLLDLEPAELDWVINRAIELKKMQHAGEIYEPLKNQVLGMIFEKSSTRTRISFEA 61 Query: 63 GMIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRVPV 122 GM Q GG AIFLS RDTQLGRGEPI DSA+VMSRM+DA+MIRT+ H + +FAA S+VPV Sbjct: 62 GMTQFGGSAIFLSSRDTQLGRGEPIEDSARVMSRMVDAIMIRTFDHEIVEKFAAYSKVPV 121 Query: 123 INGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRVAC 182 IN L+DD HPCQLLADMQT+ EHRGSIKGKTV W+GDGNNMC+SYI AA QFDF+L +AC Sbjct: 122 INALTDDFHPCQLLADMQTYKEHRGSIKGKTVTWVGDGNNMCHSYINAARQFDFKLNIAC 181 Query: 183 PAGYEPNPEFLALAGERVTIVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALFAPFQV 242 P G++P+ + + +RV I+R+PK AV + L+ TDVW SMGQEEE RM FA +QV Sbjct: 182 PEGFDPHHQLVDDNADRVQIIRNPKEAVINSDLIVTDVWASMGQEEEQQARMVKFADYQV 241 Query: 243 TRASLDLAEKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFLV 299 + +DLA D LFMHCLPAHRGEE+S +++DD SV WD+AENRLHAQKALLEFL+ Sbjct: 242 NKELMDLANPDALFMHCLPAHRGEEVSAEVMDDLDSVVWDEAENRLHAQKALLEFLM 298 Lambda K H 0.322 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 302 Length adjustment: 27 Effective length of query: 279 Effective length of database: 275 Effective search space: 76725 Effective search space used: 76725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_046008543.1 OLEAN_RS06400 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00658.hmm # target sequence database: /tmp/gapView.8780.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-122 393.9 0.1 2.6e-122 393.7 0.1 1.0 1 lcl|NCBI__GCF_000967895.1:WP_046008543.1 OLEAN_RS06400 ornithine carbamoy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000967895.1:WP_046008543.1 OLEAN_RS06400 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 393.7 0.1 2.6e-122 2.6e-122 1 303 [. 3 298 .. 3 299 .. 0.98 Alignments for each domain: == domain 1 score: 393.7 bits; conditional E-value: 2.6e-122 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 rh+l+lldl+++el ++++a +lkk +++g+ + lk++ l++iFek+stRtR+sfe++++++G+ ++ lcl|NCBI__GCF_000967895.1:WP_046008543.1 3 RHFLTLLDLEPAELDWVINRAIELKKMQHAGEIYEPLKNQVLGMIFEKSSTRTRISFEAGMTQFGGSAI 71 8******************************************************************** PP TIGR00658 70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllt 138 +l++ ++qlgr+e+i+D arv+sr+vdai++R+++he+ve++a y++vPvin+Ltd +hPcq+laD++t lcl|NCBI__GCF_000967895.1:WP_046008543.1 72 FLSSRDTQLGRGEPIEDSARVMSRMVDAIMIRTFDHEIVEKFAAYSKVPVINALTDDFHPCQLLADMQT 140 ********************************************************************* PP TIGR00658 139 ikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklelt 207 ke+ g++k+ ++++vGD+nn+++s + aa ++ +++++a+Peg++p+ ++v+ +++++ lcl|NCBI__GCF_000967895.1:WP_046008543.1 141 YKEHRGSIKGKTVTWVGDGNNMCHSYINAARQFDFKLNIACPEGFDPHHQLVDDN-------ADRVQII 202 ************************************************9988754.......569**** PP TIGR00658 208 edpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdev 276 ++pk+av ++d+i+tDvw+smG+ee++++r+ + +yqvn+el++la+p++ f+hCLPa+rGeev+ ev lcl|NCBI__GCF_000967895.1:WP_046008543.1 203 RNPKEAVINSDLIVTDVWASMGQEEEQQARMVKFADYQVNKELMDLANPDALFMHCLPAHRGEEVSAEV 271 ********************************************************************* PP TIGR00658 277 legeasivfdeaenRlhaqkavlkall 303 ++ s+v+deaenRlhaqka+l++l+ lcl|NCBI__GCF_000967895.1:WP_046008543.1 272 MDDLDSVVWDEAENRLHAQKALLEFLM 298 ***********************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (302 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.96 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory