Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 (characterized)
to candidate WP_046008675.1 OLEAN_RS07255 acetyl-CoA C-acyltransferase FadA
Query= SwissProt::P14611 (393 letters) >NCBI__GCF_000967895.1:WP_046008675.1 Length = 392 Score = 275 bits (702), Expect = 2e-78 Identities = 168/397 (42%), Positives = 234/397 (58%), Gaps = 20/397 (5%) Query: 3 DVVIVSAARTAVGKF-GGSLAKIPAPELGAVVIKAALER-AGVKPEQVSEVIMGQV-LTA 59 DVV++ A R+ +G+ G + A ++ A +I A ER G K V +VI G V T Sbjct: 7 DVVVIDAVRSPMGRSRNGVFRNVRAEDISANLINALFERNPGAKASDVEDVIWGCVNQTL 66 Query: 60 GSGQNPARQAAIKAGLPAMVPAMTINKVCGSGLKAVMLAANAIMAGDAEIVVAGGQENMS 119 G N ARQ ++ +P A T+N++CGS + A+ AA AI G+ ++ V GG E+M Sbjct: 67 EQGFNVARQISLMTVVPKEAGAQTVNRLCGSAMSAIHTAAQAIQTGNGDVFVVGGVEHMG 126 Query: 120 AAPHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREAQDEFA 179 HV + GF A + + MG+TAE + K +GITR QD FA Sbjct: 127 ---HV--NMQHGFDHNPASSKYSAKASNM--------MGLTAEMLGKMHGITRAQQDAFA 173 Query: 180 VGSQNKAEAAQKAGKFDEEIVPVLIPQRKGDPVAFKTDEFVRQGATLDSMSGLKPAFDKA 239 S A+ A G F EIVP+L G + DE +R TL+++S L+PAFD A Sbjct: 174 ERSHRLAQKATDEGDFKNEIVPMLGHDAAGKQIMVTQDETIRPETTLETLSKLRPAFDPA 233 Query: 240 G-TVTAANASGLNDGAAAVVVMSAAKAKELGLTPLATIKSYANAGVDPKVMGMGPVPASK 298 G TVTAA +S + DGAAA+++MS KAKELGL P A IK+ A AG D +MG GPVPA+K Sbjct: 234 GGTVTAATSSQITDGAAAMLLMSGKKAKELGLKPRARIKAMAVAGCDAAIMGYGPVPATK 293 Query: 299 RALSRAEWTPQDLDLMEINEAFAAQALAVHQQMGWDTSK---VNVNGGAIAIGHPIGASG 355 +AL RA T D+D E+NEAFAAQ+L + +G VN++GGAIA+GHP+G SG Sbjct: 294 KALKRAGLTAADIDFWELNEAFAAQSLPCVKDLGLKDKADEIVNIHGGAIALGHPLGCSG 353 Query: 356 CRILVTLLHEMKRRDAKKGLASLCIGGGMGVALAVER 392 RI TL++ ++++DA+ G++++CIG G G+A ER Sbjct: 354 ARISTTLINVLEQKDAQFGVSTMCIGMGQGIATVWER 390 Lambda K H 0.315 0.131 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 392 Length adjustment: 31 Effective length of query: 362 Effective length of database: 361 Effective search space: 130682 Effective search space used: 130682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory