Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_046008793.1 OLEAN_RS08010 enoyl-CoA hydratase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_000967895.1:WP_046008793.1 Length = 260 Score = 129 bits (325), Expect = 5e-35 Identities = 86/267 (32%), Positives = 141/267 (52%), Gaps = 12/267 (4%) Query: 1 MMEFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGF 60 M E ++ V +MT+T NRPE N + E + LA+ + +++ DD +R ++ G+ F Sbjct: 1 MSEKLIVEVSDHIMTITFNRPEMYNPLDPESYFLLAQAMYRLQHDDELRVAVVQANGKHF 60 Query: 61 CAGQDLND-RNVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLAL 119 +G +L+ + G PDL +P + L KPVI AV G+ +G L L Sbjct: 61 SSGLELDKWAPIFANGEYPDLP---PEHLDPYGNKGEVLTKPVIMAVQGICYTSGLELLL 117 Query: 120 GGDIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWG 179 DI IA A+F + G+ P GGT LPR G + A L G++ +A+QA EWG Sbjct: 118 NTDIRIATPEARFAQLEVQRGIYPCGGGTVRLPREIGWSNAQRYILTGDEFTAQQALEWG 177 Query: 180 MIWQVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQ----LDLERDYQ 235 M+ ++V+ + L + A+ +A+ +A G ++ A+ SA+T + Q L D Sbjct: 178 MVQELVERDQLHEHARSIAKKIAKAAPLG---VQAALRSAKTCRVHGQEAALKTLFTDLP 234 Query: 236 RLAGRSADYREGVSAFLAKRSPQFTGK 262 ++ +S D +EG+++FL +R +FTGK Sbjct: 235 KIM-KSEDAKEGIASFLQRREAKFTGK 260 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 260 Length adjustment: 25 Effective length of query: 237 Effective length of database: 235 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory