Align Propionyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.3) (characterized)
to candidate WP_046008864.1 OLEAN_RS08430 carbamoyl phosphate synthase large subunit
Query= reanno::PS:Dsui_0516 (663 letters) >NCBI__GCF_000967895.1:WP_046008864.1 Length = 1649 Score = 297 bits (760), Expect = 3e-84 Identities = 171/450 (38%), Positives = 259/450 (57%), Gaps = 12/450 (2%) Query: 3 KKILIANRGEIACRVIKTARKMGIKTVAVYSEADKDALFVEMA---DEAVCIGPAASKES 59 KK++I RG A ++IK A+ I V V S+ D +++ V+M D VCIG ES Sbjct: 1068 KKVMIHARGCTAAKLIKKAQDNNIPVVLVQSDPDMNSVAVDMLGPEDRVVCIGGNTPDES 1127 Query: 60 YLVADKIIAACKQTGAEAVHPGYGFLSENAEFSRRLEEEGIKFIGPKHYSIAKMGDKIES 119 YL A +I + +A+HPG GFLSE+++F+ GI F+GP S+ MG+K + Sbjct: 1128 YLNAKSVIRIAQHEQVDALHPGIGFLSESSQFAALCASYGINFVGPSVSSMETMGNKSNA 1187 Query: 120 KKLAIEAKVNTIPGYNDAIDGPDAAVEIAKKIGYPVMIKASAGGGGKGLRVAYNDAEAHE 179 AI A V +PG + + +A+ IGYPV++KA GGGGKG++V + HE Sbjct: 1188 INTAIAANVPVVPGSHGILTSSANTASVAEDIGYPVLLKAVHGGGGKGIQVVERPEQIHE 1247 Query: 180 GFSSCVNEARNSFGDDRVFIEKYVLEPRHIEIQVLGDSHGNYVYLNERDCSIQRRHQKVI 239 F EA+ +FG+ V++EKYV RHIE+QVL D G+ L RDCS+QR +QKV Sbjct: 1248 LFHQISTEAKAAFGNGDVYLEKYVTSLRHIEVQVLRDRFGHTKILGLRDCSVQRNNQKVF 1307 Query: 240 EEAPSPFVDPEMRKAMGEQAVALARAVNYESAGTVEFVVSGATKEFYFLEMNTRLQVEHP 299 EE+ S + + +A+ + A L+ AV+Y AGTVEF+ + YF+EMNTRLQVEHP Sbjct: 1308 EESGSTMLPKALEQAVYDYAEKLSDAVDYFGAGTVEFIYNLDEDAIYFMEMNTRLQVEHP 1367 Query: 300 VTELITGLDLVEQMIRVAYGEKLPLTQADVQINGWAMECRINAEDPFR-----GFLPSTG 354 VTE+++G+D+V +A G+ + + + G+A+E R+ AE R F P G Sbjct: 1368 VTEVVSGIDIVSAQFDIAQGKS--IAKLKPKPKGYAIEVRVTAEKAVRKGDLIDFAPFPG 1425 Query: 355 RLVKFQPPAEVDGQVRVDTGVYDGGEISMYYDSMIAKLIVHGASREQAIARMRDALNGFV 414 + + P E+D +++ T G ++S +YDSMI ++I +G R+ IA++R L+ Sbjct: 1426 TINECVLP-ELD-HIQLITSAGPGKQVSPFYDSMIVQIICYGKDRDDTIAKLRTYLDQVR 1483 Query: 415 IRGISSNIPFQAALMQHARFQSGIFDTGFI 444 I G+ +NI ++ FQ G +DT ++ Sbjct: 1484 ITGVCTNIVLLKRILDDKIFQLGDYDTTYL 1513 Lambda K H 0.319 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 2168 Number of extensions: 100 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 663 Length of database: 1649 Length adjustment: 45 Effective length of query: 618 Effective length of database: 1604 Effective search space: 991272 Effective search space used: 991272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (26.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory