Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14); 4-Hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16); (4S)-4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.42) (characterized)
to candidate WP_046009535.1 OLEAN_RS12745 keto-deoxy-phosphogluconate aldolase
Query= BRENDA::P0A955 (213 letters) >NCBI__GCF_000967895.1:WP_046009535.1 Length = 216 Score = 205 bits (521), Expect = 6e-58 Identities = 103/205 (50%), Positives = 138/205 (67%), Gaps = 6/205 (2%) Query: 11 ILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAIAKEVPEAIVG 70 + T P++PVIV+ L HA+PMAKALVAGGV +LEVTLRTE + AI AI K VPEAIVG Sbjct: 8 LANTKPLIPVIVIDDLVHAIPMAKALVAGGVHLLEVTLRTEAGLAAISAIKKAVPEAIVG 67 Query: 71 AGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIP------LIPGISTVSELMLG 124 AGTV + +AGAQF +SPGLT L++ A + + +PG++T SE+M+ Sbjct: 68 AGTVCTADDFQKAIDAGAQFIVSPGLTPELIEKAKQVKLDGQWQGVFLPGVATASEVMIA 127 Query: 125 MDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLCIGGS 184 G+ + K FPA A GG K L+A +GPF ++FCPTGGIS NY++YL L +V+C GGS Sbjct: 128 AQAGITQLKCFPASAIGGAKLLKAWSGPFPDIQFCPTGGISKDNYKEYLGLPNVICAGGS 187 Query: 185 WLVPADALEAGDYDRITKLAREAVE 209 WL + L GD++ +T+ A E V+ Sbjct: 188 WLTESKLLIEGDWNEVTRRASEIVK 212 Lambda K H 0.317 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 216 Length adjustment: 22 Effective length of query: 191 Effective length of database: 194 Effective search space: 37054 Effective search space used: 37054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory