Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_046010135.1 OLEAN_RS16520 3-hydroxyacyl-CoA dehydrogenase
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_000967895.1:WP_046010135.1 Length = 723 Score = 82.4 bits (202), Expect = 2e-20 Identities = 60/189 (31%), Positives = 96/189 (50%), Gaps = 9/189 (4%) Query: 9 QQRVLLLTLNRP-AARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFAAGADLNE 67 Q ++ L L++P A N ++N L +E D + + + FFA G +L++ Sbjct: 12 QHNIVHLILDKPNAGANLMDNEFTDSLTAAVEKLRQDDYAGIIFRSAKSTFFAGG-NLDD 70 Query: 68 M--AEKDLAATLNDTRPQL---WARLQAFNKPLIAAVNGYALGAGCELALLCDVVVA-GE 121 + K+ A L D +L L+ KP++A +NG ALG G ELAL VA + Sbjct: 71 LFTTHKENADVLYDMVNRLKLAMRELETQGKPVVACINGAALGGGWELALSAHYRVALNK 130 Query: 122 NARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSD 181 GLPE+TLG++PG GG R+ R +G A +L G+ ++ + GL+++V S Sbjct: 131 GVILGLPEVTLGLLPGGGGIIRMTRLLGVQAAMPYLLEGKQFKPEKGLKLGLINEVVDSP 190 Query: 182 LT-LEYALQ 189 L+ A+Q Sbjct: 191 AAMLQSAIQ 199 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 723 Length adjustment: 32 Effective length of query: 223 Effective length of database: 691 Effective search space: 154093 Effective search space used: 154093 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory