Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_046010385.1 OLEAN_RS18015 choline ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >NCBI__GCF_000967895.1:WP_046010385.1 Length = 402 Score = 131 bits (329), Expect = 2e-35 Identities = 75/237 (31%), Positives = 137/237 (57%), Gaps = 15/237 (6%) Query: 19 LKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNEELKLVANKDGALK 78 + +L+ + G++ ++G SGSGKS+ LRCIN L G I +++E + L Sbjct: 41 VNNANLQISKGEICVLMGLSGSGKSSLLRCINGLNDTTRGSIEIDHEGEVI------DLV 94 Query: 79 AADPKQLQRMRS-RLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSKAEAREKAELYLAKV 137 +AD L+ +R+ R+SMVFQ F L +T +N+ P+ + G+ K E +++ + L V Sbjct: 95 SADADMLRAIRTKRMSMVFQKFALMPWLTVAQNVA-MPLELQGLDKKEIKQRVDAQLELV 153 Query: 138 GVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDP----ELVGDVLKVMQ 193 G+ P +SGG QQRV +ARAL E +++L DEP SALDP +L +++++ + Sbjct: 154 GLEQWAKHKPSELSGGMQQRVGLARALVTESDILLMDEPFSALDPLIRTQLQDELIQLQE 213 Query: 194 ALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSERLQQFLS 250 L +T++ V+H++ A ++ + + G + + G P +++NP ++ ++QF++ Sbjct: 214 KL---NKTIIFVSHDLDEALKLGTNIAIMKDGEIVQQGKPESIVLNPVNDYVKQFVA 267 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 402 Length adjustment: 28 Effective length of query: 226 Effective length of database: 374 Effective search space: 84524 Effective search space used: 84524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory