Align UDP-glucose 4-epimerase; UDP-galactose 4-epimerase; Uridine diphosphate galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_048086145.1 ARCVE_RS02690 dTDP-glucose 4,6-dehydratase
Query= SwissProt::A0R5C5 (313 letters) >NCBI__GCF_000194625.1:WP_048086145.1 Length = 333 Score = 134 bits (338), Expect = 2e-36 Identities = 102/313 (32%), Positives = 152/313 (48%), Gaps = 10/313 (3%) Query: 1 MRTLVTGAAGFIGSTLVDRLLADGHGV--VGLDDLSSG-RAENLHSAENSDKFEFVKADI 57 M+ LVTG GFIGS + +L++ V + +D L G NL EN D++ FVK DI Sbjct: 1 MKLLVTGGLGFIGSNFIRYILSNYSDVEVINVDALKYGSNPNNLKDVENDDRYTFVKGDI 60 Query: 58 VDADLTGLLAEFKPEVIFHLAAQISVKRSVDDPPFDATVNVVGTVRLAEAARLAGVR-KV 116 D DL L + I + AA+ V RS+ +P NVVG + EA R K+ Sbjct: 61 SDYDLISNLIK-NVYAIVNFAAETHVDRSISNPYSFLQSNVVGVFTILEAMRKCNPNAKL 119 Query: 117 VHTSSGGSVYGTPPAYPTSEDMPVNPASPYAAGKVAGEVYLNMYRNLYDLDCSHIAPANV 176 VH S+ VYG ED + P+SPY+A K A ++++ Y Y L N Sbjct: 120 VHISTD-EVYGDILQGSFKEDDTLRPSSPYSASKAAADMFVLSYARTYGLHAMITRCTNN 178 Query: 177 YGPRQDPHGEAGVVAIFSEALLAGRTTKIFGDGSDTRDYVFVDDVVDAFVRAGGPAGGGQ 236 YG Q P E + A + I+G G + RD+++V D +A G+ Sbjct: 179 YGAYQFP--EKLIPKTIIRAAM-NMKIPIYGTGKNVRDWIYVLDHCEAINTVMQKGKKGE 235 Query: 237 RFNVGTGVETSTRELHTAIAGAVGAPDE-PEFHPPRLGDLRRSRLDNTRAREVLGWQPQV 295 +N+ +G E + E+ T I +G ++ EF R G R LD+++ R LGW+P+ Sbjct: 236 IYNISSGEEKTNLEVVTRILSIMGKDEDLIEFVEDRPGHDIRYSLDSSKIRNELGWKPKH 295 Query: 296 ALAEGIAKTVEFF 308 + EGI +TV ++ Sbjct: 296 SFEEGIKETVNWY 308 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 333 Length adjustment: 28 Effective length of query: 285 Effective length of database: 305 Effective search space: 86925 Effective search space used: 86925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory