Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_048086190.1 ARCVE_RS05005 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000194625.1:WP_048086190.1 Length = 258 Score = 216 bits (549), Expect = 4e-61 Identities = 118/239 (49%), Positives = 159/239 (66%), Gaps = 11/239 (4%) Query: 1 MLQFENVSTFYGK-IQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCG-----SPQAH 54 ML+ NV Y I L V++E+ +G IVTL+G NGAGK+T L ++ G + Sbjct: 1 MLELNNVEVVYNDFILVLKGVSIEIEKGSIVTLLGPNGAGKTTTLKSISGLIKPERGEVT 60 Query: 55 SGSIRYMGEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMGGFFTDKGDYQEQMD 114 G+I Y G+ + +D R I V EGRR+F LTVEENL G + + D+ D Sbjct: 61 RGTIVYEGKRIENRDPEENARDGIIQVMEGRRIFEELTVEENLRAGSYISGNTDF----D 116 Query: 115 KVLHLFPRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFD 174 V + FP L+E+ RGG +SGGEQQMLAIGRAL++KPKLLLLDEPSLGLAPI++++IF+ Sbjct: 117 MVYNYFPNLREKRNLRGGYLSGGEQQMLAIGRALLAKPKLLLLDEPSLGLAPIVVKEIFE 176 Query: 175 IIEQL-RKDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLG 232 II+++ R++ VT+ LVEQNA AL+IAD Y++ENGR+VM G E L + VRE Y+G Sbjct: 177 IIKRINREENVTILLVEQNAKLALEIADYGYIMENGRIVMDGEAEKLRQNEDVREFYMG 235 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 258 Length adjustment: 24 Effective length of query: 209 Effective length of database: 234 Effective search space: 48906 Effective search space used: 48906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory