Align 3-hydroxybutyryl-CoA dehydrogenase; EC 1.1.1.157 (characterized)
to candidate WP_049755189.1 AFER_RS01140 hypothetical protein
Query= CharProtDB::CH_091789 (282 letters) >NCBI__GCF_000023265.1:WP_049755189.1 Length = 298 Score = 237 bits (604), Expect = 3e-67 Identities = 119/280 (42%), Positives = 180/280 (64%) Query: 1 MKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEA 60 ++++ V+G GTM +GI + A K +VV+ D+ + + L++ V +G I E Sbjct: 14 VRRLGVVGTGTMATGIIEVAARKAIDVVVWARSDQSASAVRERLQARLAREVARGVIAEQ 73 Query: 61 TKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLS 120 E+ R+S T ++ C++++E+ VE ++ K+ +FA L ++ PET+LASNTS+L Sbjct: 74 AAHEVGERVSITRAVDDLGGCEVIVESIVEALEPKRVLFAQLGSVTGPETVLASNTSTLG 133 Query: 121 ITEVASATKRPDKVIGMHFFNPAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVEVA 180 I ++A T+ P++V G+HFFNP M+LVEV+RG+ TS T ++ + K P+EV Sbjct: 134 IGQLAQVTEHPERVCGLHFFNPVTRMELVEVVRGLETSPATIARATAFAVQLAKTPIEVE 193 Query: 181 EAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPLELGDFIGLDICLA 240 + GFVVN +L P IN AV ++ G+AS ED+D+AM LGANHP+GPL L D +GLD+ +A Sbjct: 194 DEAGFVVNALLFPSINAAVRLVERGVASAEDVDRAMVLGANHPLGPLALADLVGLDVTVA 253 Query: 241 IMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDY 280 I+D L++ TGD P L++ V AG LGRKSG GFY Y Sbjct: 254 ILDRLWAATGDPALVPAPTLRRLVAAGRLGRKSGWGFYRY 293 Lambda K H 0.319 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 298 Length adjustment: 26 Effective length of query: 256 Effective length of database: 272 Effective search space: 69632 Effective search space used: 69632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory