Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_049769578.1 DHAF_RS15840 glucokinase
Query= curated2:Q55855 (355 letters) >NCBI__GCF_000021925.1:WP_049769578.1 Length = 363 Score = 208 bits (530), Expect = 2e-58 Identities = 133/361 (36%), Positives = 196/361 (54%), Gaps = 37/361 (10%) Query: 5 GVNFLAGDIGGTKTILALVTINESSPGLARPVTLFEQTYSSPAFPDLVPMVQQFRQEAAF 64 G +LAGDIGGTKT+L L ++ + L R E+ + S + DL ++Q F E A Sbjct: 11 GQLYLAGDIGGTKTLLGLYSLEGTELVLVR-----ERNFPSKDWQDLTALIQGFLDEIAL 65 Query: 65 VLGNPISVAKACFAIAGPVIDNTCRLTNLDWHLSGDRLAQELAIAQ-VDLINDFAAVGYG 123 P + C ++AGP+ + C LTNL+ + L L + + + L+ND A+G G Sbjct: 66 T---PEDITGGCLSLAGPITQDKCFLTNLNRVIDCPDLRSSLPLRRPLLLVNDLEAMGQG 122 Query: 124 ILGLGSEDLTVLQAAPVDPSGAIA---------------ILGAGTGLGQCYVIPQGQGRY 168 ++ L EDL L + PS ++A ++ GTGLGQ ++ G Sbjct: 123 LMDLRGEDLICLNPSAESPSSSLASSPALSLARPSLNRALIAPGTGLGQAMILADG---- 178 Query: 169 RVFASEGAHGDFAPRSPLEWQLLEYLKKKYSLGRISIERVVSGMGIAMIYEFLRHQYPER 228 RV A+EGAHGD+APR+ E +L +L ++Y G +S ERV+SG G+A +Y FL Y E Sbjct: 179 RVCATEGAHGDYAPRTEQEVRLWRFLAQRY--GHVSYERVLSGPGLADLYRFL---YWEA 233 Query: 229 ESAQFSKLYQTWNREKDQETKTVDLAAAVSQAALEGTDVLADQAMELFLGAYGAEAGNLA 288 S D A +++ AL+G L + +ELF+ GAEAGNLA Sbjct: 234 LSPSLPGPASDSIPAPDSSLTP----AEITKKALDGICTLCTETLELFVKILGAEAGNLA 289 Query: 289 LKLLPRGGLYVAGGIAPKIIPLLEKGSFMQGFSDKGRMQSLMGTIPVQVVLNAKVGLIGA 348 L+ L GG+Y+ GGI PKI+P L++ FM+ F KGR++ L+ IP+ V+LN + L+GA Sbjct: 290 LRTLAYGGIYLGGGIPPKILPKLQEDGFMEAFLAKGRLRELLSQIPIYVILNERTPLLGA 349 Query: 349 A 349 A Sbjct: 350 A 350 Lambda K H 0.320 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 363 Length adjustment: 29 Effective length of query: 326 Effective length of database: 334 Effective search space: 108884 Effective search space used: 108884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_049769578.1 DHAF_RS15840 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.3387.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-78 249.5 0.0 1.1e-77 247.4 0.0 1.8 1 lcl|NCBI__GCF_000021925.1:WP_049769578.1 DHAF_RS15840 glucokinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021925.1:WP_049769578.1 DHAF_RS15840 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 247.4 0.0 1.1e-77 1.1e-77 1 315 [] 15 350 .. 15 350 .. 0.88 Alignments for each domain: == domain 1 score: 247.4 bits; conditional E-value: 1.1e-77 TIGR00749 1 lvgdiGGtnarlalvevapgeieqv..ktyssedfpsleavvrvyleeakvelkdpikgcfaiatPiig 67 l+gdiGGt++ l+l e+ v + + s+d+++l+a+++ +l+e + + +d gc+++a+Pi++ lcl|NCBI__GCF_000021925.1:WP_049769578.1 15 LAGDIGGTKTLLGLYSLEGTELVLVreRNFPSKDWQDLTALIQGFLDEIALTPEDITGGCLSLAGPITQ 83 79************9888888887777899***********************99779*********** PP TIGR00749 68 dfvrltnldWalsieelkqelalak.lelindfaavayailalkeedliqlggak.............. 121 d + ltnl+ + +l+ +l l++ l l+nd+ a++ +++ l+ edli l+ lcl|NCBI__GCF_000021925.1:WP_049769578.1 84 DKCFLTNLNRVIDCPDLRSSLPLRRpLLLVNDLEAMGQGLMDLRGEDLICLNPSAespssslasspals 152 ***********************876999*********************9854311111111111111 PP TIGR00749 122 .veesaaiailGaGtGlGvatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervl 189 + +s a++ +GtGlG+a+++ dg +v a+eG+h+d+aPr e+e+ l+++l ++yg+vs ervl lcl|NCBI__GCF_000021925.1:WP_049769578.1 153 lARPSLNRALIAPGTGLGQAMILA--DG--RVCATEGAHGDYAPRTEQEVRLWRFLAQRYGHVSYERVL 217 1123445799***********999..66..589************************************ PP TIGR00749 190 sGsGlvliyealskrkgere.......vsklskeelkekdiseaalegsdvlarralelflsilGalag 251 sG+Gl+ +y++l + + + l++ +i+++al+g ++l+ ++lelf+ ilGa+ag lcl|NCBI__GCF_000021925.1:WP_049769578.1 218 SGPGLADLYRFLYWEALSPSlpgpasdSIPAPDSSLTPAEITKKALDGICTLCTETLELFVKILGAEAG 286 ***********9877643334455433445567899********************************* PP TIGR00749 252 nlalklgarGGvyvaGGivPrfiellkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315 nlal+ +a+GG+y+ GGi P++++ l++ +f++af kGrl+ell++iP++v+l++++ llGa+ lcl|NCBI__GCF_000021925.1:WP_049769578.1 287 NLALRTLAYGGIYLGGGIPPKILPKLQEDGFMEAFLAKGRLRELLSQIPIYVILNERTPLLGAA 350 **************************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.04 # Mc/sec: 2.63 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory