Align N-Acetyl-D-glucosamine ABC transport system, permease component 2 (characterized)
to candidate WP_049778484.1 RL_RS34830 carbohydrate ABC transporter permease
Query= reanno::Phaeo:GFF2752 (280 letters) >NCBI__GCF_000009265.1:WP_049778484.1 Length = 275 Score = 160 bits (406), Expect = 2e-44 Identities = 92/267 (34%), Positives = 144/267 (53%), Gaps = 4/267 (1%) Query: 17 GALITYTLIALF---PVFVILVNSFKTRKAIFRDPLGLPTSDTFSLVGYQTVLKQGDFFL 73 G IT ++AL P I+ S KT A+ +P ++ + Y +G+F Sbjct: 9 GLWITLVIVALVWVAPFVFIVFTSLKTPAAVTGTGAFVPPTE-LAFENYSAAWSRGNFAN 67 Query: 74 YFQNSMIVTVVSLALVLLFGAMAAFALAEYRFKGNMLLGLYLALGIMIPIRIGTVAILEL 133 F NS+I+TV+ + L L AMAA+ALA+ + K L L + G MIP ++ + L Sbjct: 68 SFFNSVIITVIKVPLGLFLSAMAAYALAKIKLKITKALLLLVVFGTMIPFQVMLAPLFTL 127 Query: 134 MVDTGLVNTLTALILVYTAQGLPLAVFILSEFMKQVSDDLKNAGRIDGLSEYTIFFRLVL 193 + GL++T +IL Y A G+P VFIL F K + +L A IDG + + IF R+ L Sbjct: 128 VNSLGLIDTYPGVILPYIAFGVPYQVFILHGFFKSIPKELSEAALIDGANHFIIFRRIFL 187 Query: 194 PLVRPAMATVAVFNMIPIWNDLWFPLILAPAEETKTLTLGSQVFIGQFVTDWNAVLSALS 253 P+ P +A + + + + WN+ L+L + TL LG F GQF +++ + +A+ Sbjct: 188 PVCLPVLAALLILDFVSTWNEFAMALVLLQDQHMWTLPLGLMSFQGQFSSNYGQLNAAIV 247 Query: 254 MAILPVMVLYVIFSRQLIRGITSGAVK 280 M +LP ++Y+IF R + G+TSGAVK Sbjct: 248 MTVLPATIVYLIFQRYFVSGLTSGAVK 274 Lambda K H 0.330 0.143 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 275 Length adjustment: 25 Effective length of query: 255 Effective length of database: 250 Effective search space: 63750 Effective search space used: 63750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory