Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate WP_050460766.1 AKL27_RS01340 NAD(P)-dependent oxidoreductase
Query= SwissProt::Q92RN6 (256 letters) >NCBI__GCF_001189915.1:WP_050460766.1 Length = 252 Score = 135 bits (340), Expect = 8e-37 Identities = 78/248 (31%), Positives = 128/248 (51%), Gaps = 5/248 (2%) Query: 11 LRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDIAAESSLALCEKVAAQTGQAPHFIQA 70 L+D+ +VTGGGSG G + +A+AR+GA V DI + +++ G+A F + Sbjct: 3 LKDKVAIVTGGGSGFGEGIAKAYAREGASVMVADIGETGGHRVVKEINEAGGKA-RFFRT 61 Query: 71 DLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDR-QALEAVTEESWDESLSVNLRHLFFM 129 D+ V A + G + ++VNNA R + + V+EE +D ++N++ +F Sbjct: 62 DVSRSGDVNALLAATLEAFGGLHIVVNNAGTTHRNRPMLEVSEEEFDRVYAINVKSIFLS 121 Query: 130 CQAVAPHMQRQGGGSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLGPDNIRVN 189 PH ++ GGG+ +N +S A + P + Y+ +K +I +KS+A +LGPDNIRVN Sbjct: 122 AHTFVPHFRKVGGGAFINIASTAGIRPRPGLTWYNGSKGAVITTSKSMAAELGPDNIRVN 181 Query: 190 AILPGMIVTERQRRLW---LTEESIARMQERQCLKRMLVADDLVGPCLFLASDSSAAMTA 246 + P + T T E+ + L R DD+ CL+L SD +A +T Sbjct: 182 CVNPVISATGLLSEFMGVPDTPENRKKFTATIPLGRFSTPDDIANACLYLGSDEAAFITG 241 Query: 247 QAMIIDGG 254 + +DGG Sbjct: 242 ACLEVDGG 249 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 252 Length adjustment: 24 Effective length of query: 232 Effective length of database: 228 Effective search space: 52896 Effective search space used: 52896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory