Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate WP_050460929.1 AKL27_RS01940 FAA hydrolase family protein
Query= reanno::Smeli:SM_b21112 (281 letters) >NCBI__GCF_001189915.1:WP_050460929.1 Length = 281 Score = 315 bits (807), Expect = 7e-91 Identities = 153/277 (55%), Positives = 189/277 (68%) Query: 1 MKLLRYGEPGQEKPGLLGSDGIIRDLSGHVSDLAAGALDPSKLDELANLDVETLPAVSGN 60 MKL+R+G+PG EKP +L ++G RD+S V D + +L + E P Sbjct: 1 MKLIRHGQPGLEKPAVLDAEGRARDVSALVPDFNPETIASPAFAQLLSSKAEDYPLAPQG 60 Query: 61 PRLGPCVAGTGKFICIGLNYSDHAAETGATVPPEPIIFMKATSAIVGPNDDLVLPRGSEK 120 RLG +AGT + +GLNY+DHAAE +P EP +FMK+ +I GPND +LP +EK Sbjct: 61 QRLGAPIAGTRLIVAVGLNYADHAAEASMALPAEPALFMKSVHSICGPNDATLLPPQAEK 120 Query: 121 TDWEVELGIVIGKTAKYVSEAEALDYVAGYCTVHDVSERAFQTERHGQWTKGKSCDTFGP 180 DWE ELGI+IG+ +VSEAEAL YV GYC V+DVSER++Q ER G W KGKSCDTF P Sbjct: 121 LDWEAELGIIIGRVTSHVSEAEALSYVLGYCVVNDVSERSYQLERGGTWDKGKSCDTFTP 180 Query: 181 TGPWLVTKDEVADPQDLAMWLKVNGETMQDGSTKTMVYGAAHLVSYLSQFMSLRPGDIIS 240 GPWLVT DE D L +W KVNGETMQ GST MV+G A L+SY+SQF +L PGD+I+ Sbjct: 181 VGPWLVTPDETGDAGTLDIWCKVNGETMQQGSTAKMVFGPAALISYISQFFTLHPGDLIT 240 Query: 241 TGTPPGVGMGMKPPRYLKAGDVVELGIEGLGSQKQRV 277 TGTP GVG G KP R+L+ DVV LGI GLGSQ+Q V Sbjct: 241 TGTPAGVGFGKKPQRFLRVDDVVTLGIAGLGSQRQVV 277 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 281 Length adjustment: 26 Effective length of query: 255 Effective length of database: 255 Effective search space: 65025 Effective search space used: 65025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory