Align D-xylonate dehydratase subunit (EC 4.2.1.25; EC 4.2.1.82) (characterized)
to candidate WP_050462203.1 AKL27_RS07595 galactonate dehydratase
Query= metacyc::MONOMER-18070 (393 letters) >NCBI__GCF_001189915.1:WP_050462203.1 Length = 379 Score = 168 bits (425), Expect = 3e-46 Identities = 114/365 (31%), Positives = 183/365 (50%), Gaps = 14/365 (3%) Query: 3 KISEIEAYILGKEVTSAQWASLMVLVRVTTND-GRVGWGETVSALRAEAVANFVKKINTV 61 KI+ I+A+ V+ W V V+V T+ G +GWGE + A+ V + + Sbjct: 2 KITAIKAFATVSPVSD--W----VFVKVETDQPGLIGWGECSLPGKPNAMLGAVADLEKL 55 Query: 62 LKGNDVFNVEKNRLEWYKHDFNMTISLESTTAYSAVDIASWDIIGKELGAPLYKLLGGKT 121 + G D N E Y+H F ++ T A S VDIA WDI GK P+YKL+GG Sbjct: 56 VVGADPTNTEWCWQRMYRHAFWRGGPIQ-TAALSGVDIALWDIRGKLANQPVYKLMGGAV 114 Query: 122 RDKVLVYANGWYQNCVKPEDFAEKAKEIVKMGYKALKFDPFGPYFNDI-SKKGLDIAEER 180 RD++ +YAN + PE+ + + V +GY A+KF P P N + S + Sbjct: 115 RDRIRLYANCGLSS--DPEELRRRVRHAVSLGYTAVKFYPL-PAVNAVDSLATIRQVVAC 171 Query: 181 VKAVREAVGDNVDILIEHHGRFNANSAIMIAKRLEKYNPLFMEEPIHPEDVEGLRKYRNN 240 +AVR+ +G D ++ HGR ++ A+ I + PL++EEP+ PE + L + Sbjct: 172 CEAVRDEIGAERDFALDFHGRLSSGFAVEIESAIRHTKPLWIEEPVLPETPKALARLAEK 231 Query: 241 TSLRIALGERIINKQQALYFMKEGLVDFLQADLYRIGGVTETKKVVGIAETFDVQMAFHN 300 + IA+GER+ + ++ +Q D+ GG+TE K+ AET+ V +A HN Sbjct: 232 CVIPIAVGERLFTRFDFREVLENEWATVIQPDVANAGGITEMMKIAAFAETYGVALAPHN 291 Query: 301 AQGPILNAVTLQFDAFIPNFLIQESFYDWFPSWKRELIYNGTPID-NGYAIIPERPGLGV 359 GP+ + + A + F+I E ++ + +L N + +GY +P+ PGLG+ Sbjct: 292 PNGPVQSIAGMHLAAALQPFVILEHRHE-HHDFLEQLADNIPKVGADGYVGLPKGPGLGI 350 Query: 360 EVNEK 364 VNE+ Sbjct: 351 HVNEE 355 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 379 Length adjustment: 30 Effective length of query: 363 Effective length of database: 349 Effective search space: 126687 Effective search space used: 126687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory