Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_050464693.1 AKL27_RS20355 fumarylacetoacetase
Query= BRENDA::Q94272 (418 letters) >NCBI__GCF_001189915.1:WP_050464693.1 Length = 447 Score = 386 bits (991), Expect = e-112 Identities = 219/435 (50%), Positives = 278/435 (63%), Gaps = 23/435 (5%) Query: 1 MKSFVSVPQNSD--FPIQNLPYGVFSTKADSSR-HIGVAIGDQILNL--AEIANLF---D 52 ++S+VS D FPIQNLPYG+F + S + GVAIGDQIL+L A A F D Sbjct: 13 LRSWVSSANADDNEFPIQNLPYGIFRRRGSSEQFRAGVAIGDQILDLRVAHAAGAFVAAD 72 Query: 53 GPQLKAHQDVFKQSTLNAFMALPRPAWLEARARIQQLLSEDCAVLRDNAHLRSRALVAQS 112 A +TLN M L AW R + +LL DC+ + L + LVAQS Sbjct: 73 AQTQAAVHAAVAGATLNPLMDLDAGAWSALRLALSRLLRSDCSAAQQA--LLTPCLVAQS 130 Query: 113 DATMHLPAQIGDYTDFYSSIHHATNVGIMFRGKENALMPNWKWLPVGYHGRASSIVVSGT 172 DA LPAQIGDYTDFY+SIHHAT +G +FR +N L+PN+KW+P+GYHGRASSI VSG Sbjct: 131 DAEHALPAQIGDYTDFYTSIHHATAIGKLFR-PDNPLLPNYKWVPIGYHGRASSIDVSGQ 189 Query: 173 DLKRPVGQTKAPDAEVPSFGPSKLMDFELEMAFFVGGPENELGTRVPIEKAEDRIFGVVL 232 +RP+GQT+APDAEVP FGP K +D+ELE+ F+G N LG +P+ AE +FG+ L Sbjct: 190 QFRRPLGQTRAPDAEVPVFGPCKRLDYELEVGVFIGNG-NALGEAIPMANAEAHVFGLCL 248 Query: 233 MNDWSARDIQAWEYVPLGPFLAKSFATTVSPWVVSIEALRPYFV--ENPVQDPVPPAYLH 290 +NDWSARD+QAWEY PLGPFLAK+FA+T+SPW+V++EAL PY DP P YL Sbjct: 249 LNDWSARDMQAWEYQPLGPFLAKNFASTISPWIVTLEALAPYRAGWTRDSADPQPLPYLD 308 Query: 291 H---DDPFTLDINLAVSIRP----EGDAVDHIVCKTNFKHLYWTLKQQLAHHTVNGCNLR 343 D LD+ L V I+ H + +NF+ YW++ Q +AHHTVNGCNLR Sbjct: 309 DAGLRDHGALDVQLEVLIQTPAMRSAGLAPHRLSLSNFRDSYWSVSQLVAHHTVNGCNLR 368 Query: 344 AGDLLGSGTVSGPEEGAYGSMLELSWRGAKEVPV-GSEIRKFLKDGDEVNLSGVCEKNG- 401 GDLLGSGT SGP A GS+LEL+ G + + + G E R F++DGD + + G ++G Sbjct: 369 GGDLLGSGTQSGPTPEAAGSLLELTAGGKQALTLPGGETRIFIQDGDTIIMRGSARRDGW 428 Query: 402 VRIGFGECRGKVLPA 416 RIGFGE G VLPA Sbjct: 429 PRIGFGEVAGTVLPA 443 Lambda K H 0.319 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 549 Number of extensions: 25 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 447 Length adjustment: 32 Effective length of query: 386 Effective length of database: 415 Effective search space: 160190 Effective search space used: 160190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_050464693.1 AKL27_RS20355 (fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.25750.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-170 551.8 0.0 5.7e-170 551.6 0.0 1.0 1 lcl|NCBI__GCF_001189915.1:WP_050464693.1 AKL27_RS20355 fumarylacetoacetas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001189915.1:WP_050464693.1 AKL27_RS20355 fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 551.6 0.0 5.7e-170 5.7e-170 1 419 [. 15 443 .. 15 444 .. 0.95 Alignments for each domain: == domain 1 score: 551.6 bits; conditional E-value: 5.7e-170 TIGR01266 1 sfvavak..nsdfplqnlPyGvfstkadssr.rigvaiGdqildlskiaaaglfeglalkehq..e.vf 63 s+v++a+ + +fp+qnlPyG+f + +s++ r gvaiGdqildl +++aag f +++++ + ++ lcl|NCBI__GCF_001189915.1:WP_050464693.1 15 SWVSSANadDNEFPIQNLPYGIFRRRGSSEQfRAGVAIGDQILDLRVAHAAGAFVAADAQTQAavHaAV 83 899998866899************7766544389********************987555444013146 PP TIGR01266 64 kestlnaflalgrparkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfyssi 132 ++tln ++ l a+ ++r l +ll +++ ++al + l+aq++a+ lPaqiGdytdfy+si lcl|NCBI__GCF_001189915.1:WP_050464693.1 84 AGATLNPLMDLDAGAWSALRLALSRLLRSDCSA--AQQALLTPCLVAQSDAEHALPAQIGDYTDFYTSI 150 789*************************99988..77889999************************** PP TIGR01266 133 rhatnvGilfrgkdnallPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlel 201 +hat +G+lfr +dn+llPnyk++P+gyhGrass+ vsG + rrP Gq++a++a++Pvfgpck+ld+el lcl|NCBI__GCF_001189915.1:WP_050464693.1 151 HHATAIGKLFR-PDNPLLPNYKWVPIGYHGRASSIDVSGQQFRRPLGQTRAPDAEVPVFGPCKRLDYEL 218 ***********.********************************************************* PP TIGR01266 202 elaffvgtenelGeavpiekaeehifGvvllndwsardiqaweyvPlGPflaksfattvsPwvvsieal 270 e+++f+g++n+lGea+p+ +ae h+fG++llndwsard+qawey+PlGPflak+fa+t+sPw+v++eal lcl|NCBI__GCF_001189915.1:WP_050464693.1 219 EVGVFIGNGNALGEAIPMANAEAHVFGLCLLNDWSARDMQAWEYQPLGPFLAKNFASTISPWIVTLEAL 287 ********************************************************************* PP TIGR01266 271 ePfrvaqlePeqdpkplpylredr..adtafdielevslkteGlae....aavisrsnakslywtlkqq 333 P+r ++ + dp+plpyl + ++ a+d++lev ++t ++ ++++s sn+++ yw+++q lcl|NCBI__GCF_001189915.1:WP_050464693.1 288 APYRAGWTRDSADPQPLPYLDDAGlrDHGALDVQLEVLIQTPAMRSaglaPHRLSLSNFRDSYWSVSQL 356 ******9*************998555***************9999888889****************** PP TIGR01266 334 lahhsvnGcnlraGdllgsGtisGkeeeafGsllelsakGkkevkladgetrkfledGdevilrgvckk 402 +ahh+vnGcnlr GdllgsGt sG+ +ea Gsllel+a+Gk+++ l getr f++dGd++i+rg +++ lcl|NCBI__GCF_001189915.1:WP_050464693.1 357 VAHHTVNGCNLRGGDLLGSGTQSGPTPEAAGSLLELTAGGKQALTLPGGETRIFIQDGDTIIMRGSARR 425 ********************************************************************* PP TIGR01266 403 eGvr.vGfGecaGkvlpa 419 +G +GfGe aG+vlpa lcl|NCBI__GCF_001189915.1:WP_050464693.1 426 DGWPrIGFGEVAGTVLPA 443 **855************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (447 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.86 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory